KEGG   Synechococcus sp. WH8102: SYNW2210Help
Entry
SYNW2210          CDS       T00144                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
syw  Synechococcus sp. WH8102
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNW2210 (hemD)
Enzymes [BR:syw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SYNW2210 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2106419..2107207
Genome map
AA seq 262 aa AA seqDB search
MSQPLQNCTVVVTRAADQLGEARRLLETQGAQVLDLPALVIGPPDDWGPLDDALSELEDF
HWLVVSSANGVQAVEQRLQRLGRSLLRRPANLRIAAVGRKTARALEDLGATADFVPPSFV
ADSLIDHFPVSGYGLRMLLPRVQSGGRTVLAEAFGEAGVRVVEVAAYESRCPDAMPERTA
EALEAGTVDAILFSSGKTAAHTAQLLLQRFGPGWEQRLETLKLVSIGPQTSRSCREWFGR
IDAEADPHDLEGLVSACRSLLR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgagccagcctctgcagaactgcacggtggtggtgacccgcgccgccgaccaactgggg
gaagccaggcgactgttggaaacccaaggcgcacaggtgctcgacctccccgccttggtg
atcggccctcccgacgactggggaccgctggatgatgccctctcagagctggaggacttc
cactggctggtggtgtcgagcgccaatggcgtgcaggcggtggagcagcggttgcaacgc
ctcggccgcagcctgctgcggcgtcccgccaacctgcgcatcgccgctgtgggtcgcaaa
accgccagagccctggaagaccttggcgccacagccgatttcgtgccgccaagcttcgtc
gccgacagcctgatcgaccactttcccgtctccggctatggcctgaggatgcttctgcca
cgggtgcagagcggcggcagaaccgtgctggcggaagccttcggggaagctggggtgagg
gtggtggaggtggcggcctacgagtcccgctgtcccgacgccatgcccgagcgcaccgcc
gaagcccttgaggctggaacggtggacgccattttgttcagcagcggtaagacggccgcc
cacacggcacaactgctgctgcagcgcttcggtcctggctgggagcaacggctggagact
ctgaaattggtgtccatcggcccccaaaccagccgcagctgccgcgaatggttcggccgc
atcgatgcggaagctgacccccatgacctggagggcctggtgagcgcttgtcgctcgcta
ctgcgctga

DBGET integrated database retrieval system