KEGG   Synechococcus sp. WH8102: SYNW2280Help
Entry
SYNW2280          CDS       T00144                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNW2280 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNW2280 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNW2280 (trpB)
Enzymes [BR:syw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYNW2280 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2176090..2177346)
Genome map
AA seq 418 aa AA seqDB search
MTSTLPNASTPDPASLQPSVRPGAHGRFGRFGGQYVPETLMPALAELEQAAAQAWNDPAF
TAELNQLLKNYVGRATPLYEAERLTAHYRRADGGPRIWLKREDLNHTGAHKINNALGQAL
LALRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGAEDMRRQALNVFRMRLLGATV
QPVTAGTATLKDATSEAIRDWVTNVESTHYILGSVAGPHPYPMLVRDFHAVIGQEARQQC
REAFGRLPDVLMACVGGGSNAMGLFHPFVECTNVRLIGVEAAGDGVATGRHAATITEGRA
GVLHGAMSLLLQDSDGQVQEAHSISAGLDYPGVGPEHSYLREIGRAEYGAVTDQQALGAL
RLVSELEGIIPALETAHAFAWLEQLCPTLPDGSEVVINCSGRGDKDVNTVAEKLGDQL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccctgccgaacgccagcactccggatcccgccagtctgcaaccttccgtg
cgtcctggagcccacggacgcttcggtcgcttcggtgggcagtacgttccggagaccctg
atgccggccctggcggagctggaacaggcggcggcccaggcctggaacgacccagccttc
accgcagaactcaaccagctgctcaagaactatgtcggtcgggccacacctctctatgaa
gctgaacgcctcacggcccattaccgccgcgccgacggcggcccccgcatctggctgaag
cgtgaggacctgaatcacaccggagcccacaagatcaacaatgcccttggtcaggcgttg
ctagccctgcgcatgggcaagaagcggatcattgcggaaaccggtgccggccagcacggg
gtggccaccgccaccgtctgcgcccgtttcggcctcgagtgcgtgatttatatgggcgct
gaggacatgcgccgtcaggccctcaatgtgttccgaatgcgcctgctgggggccacggtt
caaccggtcacggccggcaccgccaccctcaaggacgccaccagcgaagcgatccgcgac
tgggtcaccaacgtggaatccacccactacattctcggttccgttgctggcccgcatccc
taccccatgcttgtgcgggatttccatgccgtgatcggccaggaagcccgtcagcagtgc
cgcgaggccttcgggcgcctgccggatgtgctgatggcctgcgtgggcggtggctccaat
gccatggggctgttccaccccttcgtggaatgcaccaatgttcgtttgatcggtgtcgag
gccgccggtgatggcgtggccaccggtcgccatgccgccacgatcaccgaaggccgcgcc
ggggtgctccatggcgccatgagcctgctgctccaggactccgacggccaggtgcaggaa
gcccattccatcagtgctggactcgattatcccggcgtgggtccagagcacagctatctg
cgtgagatcggacgggccgagtacggcgctgtcaccgatcagcaggccctgggtgccctg
cgtctggtcagcgagctggagggcatcattcccgccctggagactgcccacgccttcgcc
tggctggagcagctctgccccaccttgcccgacggcagcgaggtggtgatcaactgctcc
ggtcgtggcgacaaggacgtcaacaccgtggccgaaaagctgggggatcagctctaa

DBGET integrated database retrieval system