KEGG   Synechococcus sp. WH8102: SYNW2377Help
Entry
SYNW2377          CDS       T00144                                 

Gene name
desC
Definition
(GenBank) Delta-9 fatty ac id desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw01040  Biosynthesis of unsaturated fatty acids
syw01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SYNW2377 (desC)
Enzymes [BR:syw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SYNW2377 (desC)
Lipid biosynthesis proteins [BR:syw01004]
 Desaturase
  First
   SYNW2377 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: CAE08892
JGI: SYNW2377
CyanoBase: SYNW2377
CYORF: SYNW2377
UniProt: Q7U3Q3
Position
2286168..2287028
Genome map
AA seq 286 aa AA seqDB search
MQAPRGPLPARQRKLKMGTTSFMVVMHVLATVALLPRFWSWQGLVAFGVLYWVTVLGVTL
GLHRLVAHRSLVVPVWVERMLVIMGTLACQSGPIEWVGLHRHHHRFSDQPIDHHDAGRGL
WWSHSEWMLHDIPALKELDRYAGDLQVDPFYRWLDRWFLLLQIPLGLGLYWIGEAAQVHG
GGIGLVLWAIPLRLVIVYHVTWLVNSATHAFGYRNFDCPDLSRNCWWVALLSFGEGWHNN
HHAHPASARHGLRWFEFDLTWQHVRLLKRLGLASRVRTARYVPGAS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcaccccgtggccctctaccggcccgacagcgcaagctcaagatgggcaccacc
agcttcatggtggtgatgcatgtgctggccaccgtggcactgctgccgcggttctggagc
tggcagggtcttgtggccttcggagttctgtactgggtgaccgtccttggcgtcaccttg
ggcctgcaccggttggtcgcccaccgcagcctggtggttccggtctgggtggagcgcatg
ctggtgatcatgggcaccttggcctgccagagcggaccgatcgaatgggttggcctacac
cgccatcaccaccgcttctccgatcaaccgatcgatcaccatgatgccggacgcggtttg
tggtggagccacagcgagtggatgttgcatgacattcctgcgctgaaggaactcgatcgc
tacgccggtgatctccaggttgacccgttctatcgctggctggaccgctggttcctgttg
ctgcagatccccctggggcttggtctgtactggatcggtgaagccgctcaagtgcatggt
ggtggaatcggactggtgctttgggccatccccctgcgtttggtaatcgtctatcacgtg
acttggctggtcaattccgccacccacgcctttggctaccgcaactttgactgcccggat
ctgtcgcggaactgctggtgggtagcgctgctctccttcggtgagggttggcacaacaac
catcacgcccacccagcgagcgcccgccatggtctgcgctggtttgagtttgacctcacc
tggcaacacgttcgcctgctcaagcgccttggccttgcgagccgcgtgagaacggctcga
tatgtgcccggggcttcctga

DBGET integrated database retrieval system