KEGG   Synechococcus sp. WH8102: SYNW2422Help
Entry
SYNW2422          CDS       T00144                                 

Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syw  Synechococcus sp. WH8102
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYNW2422
Enzymes [BR:syw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SYNW2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2326206..2327066
Genome map
AA seq 286 aa AA seqDB search
MTPFDSEGGIFMGSRRDPAGCRVGLFGVPYDGTTSFRPGTRFGPAAIREVSQGLETYCPQ
LDLDLEDLAYADLGAVDIPFGAPEPVVNAVQQATTAVLDLGLKPLMLGGEHSISSGAVAA
VANQHPDLVLVQLDAHADLREEWLGTRHSHACAMRRCLEVLPSGDLLQLAIRSGTRSEFH
ELHSSGRRMDDVQALRDAMAPWTGRPIYLTVDLDWFDPAVLPGTGTPEPGGFLWGDFAAV
VDVLSGHRLVAGDVVELAPQLDSSGVSSVLAAKVTRSLILLLGADQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacccctttcgacagcgaaggcggcatcttcatgggatcccggcgcgacccagccggc
tgccgcgtcggcctgttcggcgttccctacgacggcaccacctcctttcggccaggcacc
cgtttcggacctgcagcgatccgtgaggtcagccaaggcctggaaacctattgcccgcag
cttgatctggatctagaggatctggcctatgccgatctcggtgctgttgatatccccttc
ggtgcaccggaaccggtcgtgaacgccgtgcagcaggccacgacggctgtgctcgatctg
ggtctgaaacctctgatgctgggcggtgagcattcgatcagctccggcgctgtggccgcc
gttgccaaccaacatcccgatctggtgctggtgcagctggatgcccatgccgatctcaga
gaggagtggctcggtacccgccacagccacgcctgcgccatgcggcgctgcctggaggtg
ctgcccagtggcgacctgctgcagctggcgattcgcagcggcacccgcagcgaattccat
gagctgcacagcagtggtcgacgcatggatgacgtccaggccctgagggatgccatggct
ccctggaccggccgcccgatttatctcaccgtggatctggactggtttgatccagccgtt
ctgcctggaacgggtacccccgagccagggggcttcctatggggggatttcgcggccgta
gttgatgtgctgagtggccatcggcttgtggctggcgacgtggtggaactggcaccgcaa
ctcgacagcagtggggtcagctccgttctggccgccaaagtgacacgcagcctgattttg
ctattgggtgccgatcaataa

DBGET integrated database retrieval system