KEGG   Synechococcus sp. WH8102: SYNW2526Help
Entry
SYNW2526          CDS       T00144                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNW2526 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNW2526 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SYNW2526 (thrC)
Enzymes [BR:syw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SYNW2526 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2433061..2434167
Genome map
AA seq 368 aa AA seqDB search
MSLFQNLRRRFAATPVMQDWPGLIEAYRAWLPVTSTTPVITLREGATPLIPVPAIEERIG
KGVKVFVKYDGLNPTGSFKDRGMTMAISKAKEAGCEAVICASTGNTSAAAAAYARRGGMR
AFVLIPDGYVAQGKLAQALVYGAEVLAIRGNFDRALDIVREAAEKYPVTLVNSVNPYRLQ
GQKTAAFEVVDALGDAPDWLCIPMGNAGNITAYWMGFQEYRQAGHSRTLPRMMGFQASGS
APLVNDTTVSDPDTIATAIRIGNPVNRAKAIAARQASNGAFLDVTDAEIIEAYKLLGGQE
GIFCEPASAASVAGLLKRKDEVPAGATVVCVLTGNGLKDPDCAINNNDAAFHTDLNPDLA
TVAGVMGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgttccagaacctccgtcggcgctttgcggccacccctgtgatgcaggactgg
cccggtctgatcgaggcctacagagcttggctaccggtgacctccaccacgcccgtgatc
accctcagggagggggcgactccactgatccctgtacccgcaatcgaggagcggatcggc
aagggtgtgaaggtcttcgtcaagtacgacggtctcaacccgaccggatccttcaaggat
cggggcatgaccatggccatcagcaaggccaaggaagccggctgcgaggctgtgatctgc
gccagtaccggcaacaccagtgcagcagccgcggcctacgcccgtcgcggtggcatgcgg
gccttcgtgctgatccccgacggatacgtcgcccagggaaaactggcgcaggccctcgtc
tacggcgctgaggttctggcgattcgcggcaatttcgaccgcgctctggacatcgttcgc
gaagcagcggagaagtaccccgtgacgctggtgaactcagtgaacccctaccgacttcag
ggccagaaaaccgctgcctttgaagtcgtcgatgcccttggtgatgcccccgattggctg
tgcatccccatgggcaacgccggcaacatcacggcctactggatggggttccaggaatac
cgacaagccggtcacagccgcacactgccgcgcatgatgggcttccaggccagcggctcc
gcaccgttggtcaacgacaccaccgtgagcgatccggacacgattgcaaccgcgattcgc
atcggcaatccggtgaaccgcgccaaagcgatcgccgctcgtcaagccagcaacggtgcc
ttcctcgacgtcaccgatgccgaaatcattgaggcctacaagcttctgggtggccaggaa
ggcatcttctgcgaaccggccagtgcagcctccgtcgcaggtctgttaaagcggaaagat
gaggtcccggcgggagcgaccgtggtctgcgtgctcaccggcaatggcctgaaggatccg
gattgcgccatcaacaacaacgatgccgccttccatacagacctgaaccccgatctcgcc
acggtggcgggagtcatgggtttttaa

DBGET integrated database retrieval system