KEGG   Synechococcus sp. WH8102: SYNW2526Help
Entry
SYNW2526          CDS       T00144                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
syw  Synechococcus sp. WH8102
Pathway
syw00260  Glycine, serine and threonine metabolism
syw00750  Vitamin B6 metabolism
syw01100  Metabolic pathways
syw01110  Biosynthesis of secondary metabolites
syw01120  Microbial metabolism in diverse environments
syw01230  Biosynthesis of amino acids
Module
syw_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNW2526 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SYNW2526 (thrC)
Enzymes [BR:syw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SYNW2526 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TPR_14 TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CAE09041
JGI: SYNW2526
CyanoBase: SYNW2526
CYORF: SYNW2526
UniProt: Q7U3A6
Position
2433061..2434167
Genome map
AA seq 368 aa AA seqDB search
MSLFQNLRRRFAATPVMQDWPGLIEAYRAWLPVTSTTPVITLREGATPLIPVPAIEERIG
KGVKVFVKYDGLNPTGSFKDRGMTMAISKAKEAGCEAVICASTGNTSAAAAAYARRGGMR
AFVLIPDGYVAQGKLAQALVYGAEVLAIRGNFDRALDIVREAAEKYPVTLVNSVNPYRLQ
GQKTAAFEVVDALGDAPDWLCIPMGNAGNITAYWMGFQEYRQAGHSRTLPRMMGFQASGS
APLVNDTTVSDPDTIATAIRIGNPVNRAKAIAARQASNGAFLDVTDAEIIEAYKLLGGQE
GIFCEPASAASVAGLLKRKDEVPAGATVVCVLTGNGLKDPDCAINNNDAAFHTDLNPDLA
TVAGVMGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgttccagaacctccgtcggcgctttgcggccacccctgtgatgcaggactgg
cccggtctgatcgaggcctacagagcttggctaccggtgacctccaccacgcccgtgatc
accctcagggagggggcgactccactgatccctgtacccgcaatcgaggagcggatcggc
aagggtgtgaaggtcttcgtcaagtacgacggtctcaacccgaccggatccttcaaggat
cggggcatgaccatggccatcagcaaggccaaggaagccggctgcgaggctgtgatctgc
gccagtaccggcaacaccagtgcagcagccgcggcctacgcccgtcgcggtggcatgcgg
gccttcgtgctgatccccgacggatacgtcgcccagggaaaactggcgcaggccctcgtc
tacggcgctgaggttctggcgattcgcggcaatttcgaccgcgctctggacatcgttcgc
gaagcagcggagaagtaccccgtgacgctggtgaactcagtgaacccctaccgacttcag
ggccagaaaaccgctgcctttgaagtcgtcgatgcccttggtgatgcccccgattggctg
tgcatccccatgggcaacgccggcaacatcacggcctactggatggggttccaggaatac
cgacaagccggtcacagccgcacactgccgcgcatgatgggcttccaggccagcggctcc
gcaccgttggtcaacgacaccaccgtgagcgatccggacacgattgcaaccgcgattcgc
atcggcaatccggtgaaccgcgccaaagcgatcgccgctcgtcaagccagcaacggtgcc
ttcctcgacgtcaccgatgccgaaatcattgaggcctacaagcttctgggtggccaggaa
ggcatcttctgcgaaccggccagtgcagcctccgtcgcaggtctgttaaagcggaaagat
gaggtcccggcgggagcgaccgtggtctgcgtgctcaccggcaatggcctgaaggatccg
gattgcgccatcaacaacaacgatgccgccttccatacagacctgaaccccgatctcgcc
acggtggcgggagtcatgggtttttaa

DBGET integrated database retrieval system