KEGG   Synechococcus sp. WH7803: SynWH7803_0029Help
Entry
SynWH7803_0029    CDS       T00524                                 

Gene name
gap1
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syx  Synechococcus sp. WH7803
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SynWH7803_0029 (gap1)
   01230 Biosynthesis of amino acids
    SynWH7803_0029 (gap1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynWH7803_0029 (gap1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynWH7803_0029 (gap1)
Enzymes [BR:syx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     SynWH7803_0029 (gap1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
34586..35611
Genome map
AA seq 341 aa AA seqDB search
MTLRVAINGFGRIGRNVMRGWLSRGADTGLEIVGMNSTSDPKTSAHLLTYDSILGHIDRS
VQIETTDDTMIVNGKEIKFFADRNPLNCPWKDWGVDLVIESTGVFNTDEKASMHLEAGAS
KVILTAPGKGDGVGTFVVGVNDDQYRHEDWKILSNASCTTNCLAPIVKVLDQSFGLDWGL
MTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAVALVYPEVKGKLTGFAMRV
PTPNVSAVDLTFGPSRATTVDEVKAVIKAASENGMKGIIKYSDLPLVSTDYAGTNESTIF
DADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVARNWK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgttgcgatcaatggattcggccgaattggtcgcaatgtgatgcggggt
tggctgagccgcggagctgataccggactcgagatcgtggggatgaactccacatccgat
cccaaaaccagcgcccacctcctcacctacgactcgatcctcggtcacatcgatcgcagc
gttcagatcgaaaccaccgacgacacgatgatcgtcaacggcaaggagatcaaattcttc
gctgatcgcaatcccctcaactgcccctggaaggattggggtgtggatctggtgatcgag
tccaccggtgtgttcaacactgatgagaaagccagcatgcaccttgaagccggtgccagc
aaggtgatcctcacggcgcctggcaaaggcgacggtgtgggcaccttcgtggtgggtgtg
aacgacgatcagtaccgccacgaagattggaaaatcctttccaacgccagctgcaccacc
aactgcctggctccgatcgtgaaggttctggatcagagcttcggcttggattggggtctg
atgaccaccattcacagctacaccggtgaccagcgcatcctcgacaacagccacagggac
ctgcgtcgtgcccgtgctgctgccctcaacatggttcccaccaccaccggtgctgccaag
gctgtggctctggtttaccccgaggtgaagggcaagctcaccggtttcgccatgcgcgtg
cccacccccaatgtgtccgctgttgacctcaccttcggtccgtcccgcgccacaaccgtg
gatgaggtgaaggctgtgatcaaggccgcttccgagaacggcatgaagggcatcatcaag
tacagcgacctgcccctggtttccaccgattacgccggcaccaacgaatccaccatcttt
gatgccgacctcacctacgccatgggtgacaaggcggtgaagatccttgcctggtacgac
aacgagtggggctacagccagcgcgtggtggatctggccgaagtggtggcccgcaactgg
aagtga

DBGET integrated database retrieval system