KEGG   Synechococcus sp. WH7803: SynWH7803_0103Help
Entry
SynWH7803_0103    CDS       T00524                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
syx  Synechococcus sp. WH7803
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:syx00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:syx00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
103810..104427
Genome map
AA seq 205 aa AA seqDB search
MPAEALHTAAGQCLPGPLLITPRVFADERGFFYESWNERRFRAELIEAGVPAAEAEALVF
RQDNHSRSSRGVLRGLHYQLPPEPQGKLVRCSLGAIFDVAVDLRRASPTYGQWVGAELSA
ANHQQLWVPVGFAHGFLTLTDVAEVQYKASGFWNRDCERSLRWDDSALAIAWPLEQAGVS
EPLLAPKDADAPLLASLDAAAEVFP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgaagcgctccacaccgccgccggccaatgcctgccgggccctttgctgatt
accccccgggtgtttgccgacgagcgcggctttttctacgagagctggaacgagcgccgc
tttcgcgctgagctgatcgaggccggtgtgcccgccgccgaggcggaggcgctggtcttc
cgccaagacaaccattcccgctccagccgcggggtgttgcggggcctgcactaccagttg
ccccccgaaccccagggcaagctggtgcgctgcagcctgggtgccatctttgatgtggcc
gtggatctgcgccgggcttcgcccacctatgggcagtgggtgggcgccgagctcagcgcc
gcaaaccatcagcagctctgggtgccggtgggctttgcccatggcttcctcaccctcacg
gatgtggcggaagtgcaatacaaagccagcggcttctggaaccgcgactgcgaacgctcc
ctgcgctgggatgattcggccctcgcaatcgcctggcctttggagcaagcgggtgtgtcc
gagccgttgctggcgcccaaggacgccgacgcaccgctgctggccagcttggacgcagcc
gctgaggtgtttccgtga

DBGET integrated database retrieval system