KEGG   Synechococcus sp. WH7803: SynWH7803_0103Help
Entry
SynWH7803_0103    CDS       T00524                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00521  Streptomycin biosynthesis
syx00523  Polyketide sugar unit biosynthesis
syx01130  Biosynthesis of antibiotics
Module
syx_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SynWH7803_0103 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SynWH7803_0103 (rfbC)
Enzymes [BR:syx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SynWH7803_0103 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom RNA_pol_inhib
Motif
Other DBs
NCBI-ProteinID: CAK22529
CyanoBase: SynWH7803_0103
CYORF: SynWH7803_0103
UniProt: A5GHW4
Position
103810..104427
Genome map
AA seq 205 aa AA seqDB search
MPAEALHTAAGQCLPGPLLITPRVFADERGFFYESWNERRFRAELIEAGVPAAEAEALVF
RQDNHSRSSRGVLRGLHYQLPPEPQGKLVRCSLGAIFDVAVDLRRASPTYGQWVGAELSA
ANHQQLWVPVGFAHGFLTLTDVAEVQYKASGFWNRDCERSLRWDDSALAIAWPLEQAGVS
EPLLAPKDADAPLLASLDAAAEVFP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgaagcgctccacaccgccgccggccaatgcctgccgggccctttgctgatt
accccccgggtgtttgccgacgagcgcggctttttctacgagagctggaacgagcgccgc
tttcgcgctgagctgatcgaggccggtgtgcccgccgccgaggcggaggcgctggtcttc
cgccaagacaaccattcccgctccagccgcggggtgttgcggggcctgcactaccagttg
ccccccgaaccccagggcaagctggtgcgctgcagcctgggtgccatctttgatgtggcc
gtggatctgcgccgggcttcgcccacctatgggcagtgggtgggcgccgagctcagcgcc
gcaaaccatcagcagctctgggtgccggtgggctttgcccatggcttcctcaccctcacg
gatgtggcggaagtgcaatacaaagccagcggcttctggaaccgcgactgcgaacgctcc
ctgcgctgggatgattcggccctcgcaatcgcctggcctttggagcaagcgggtgtgtcc
gagccgttgctggcgcccaaggacgccgacgcaccgctgctggccagcttggacgcagcc
gctgaggtgtttccgtga

DBGET integrated database retrieval system