KEGG   Synechococcus sp. WH7803: SynWH7803_0258Help
Entry
SynWH7803_0258    CDS       T00524                                 

Gene name
chlD
Definition
protoporphyrin IX Mg-chelatase subunit ChlD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
syx  Synechococcus sp. WH7803
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SynWH7803_0258 (chlD)
Enzymes [BR:syx01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SynWH7803_0258 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(280903..283089)
Genome map
AA seq 728 aa AA seqDB search
MGRQTFMVSGGGVASGVAKTAAMDQANRAFPLAAITGHGTLKLALMLAAVDPGLGGVIIA
GGRGTGKSVLARGLHALLPPIEILDPANAPVPIGPGRNLDPQRPEEWGSSLRDTLGAEPA
STVIPAPFVQVPLGITEDRLVGAVDVTASLSSGSPVFQPGLLAEAHRGVLYVDELNLLDD
GIVNLLLAAVGAGENQVEREGLSLSHPCRPLLIATYNPEEGNVRDHLLDRFAIALSADQL
VSTEQRVEITNAVLSHGQCSRSFAERWKEDTDALATQLLLARQWLPDVQISREQIEYLVT
EAIRGGVEGHRSELYAVRVAKAHAALSGRDQVEADDLQVAVALVIAPRASQLPPPDQQME
PPPPPEQPDDQTPPPPPDPGEQNSDDTPPPPEGSADDDNDPPEDSSDDNDSEDDDSNDDE
DSEQDEAPPSVPEEFMLDPEAVAIDPDLLLFNAAKSKSGNSGSRSVVLSDSRGRYVKPML
PRGPVRRIAVDATLRAAAPYQKARRARQPERTVIVEESDLRAKLLQRQAGALVIFLVDAS
GSMALNRMQSAKGAVIRLLTEAYENRDEVALIPFRGDQAEVLLPPTRSITAARRRLESMP
CGGGSPLAHGLTQAARVGANALATGDLGQVVVVAITDGRGNVPLSTSLGQPELEGEEKPD
LKQEVLDVAGRYRMLEIKLLVIDTERKFIGSGMGKDLAEAAGGKYVQLPKASDQAIAAVA
MEAINSVT
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggccggcaaacgttcatggtttcaggtggaggggtcgccagcggcgtggccaagaca
gcagcgatggatcaagccaaccgcgcctttccgttggcggcgatcaccggccatggaacc
ctgaagctcgccctgatgctggctgctgtggatccagggctgggcggcgtgatcatcgcc
ggcggccgaggcaccggcaagtcagtgctggcacggggtctgcatgccttgctcccaccg
attgaaatcctcgacccagccaacgcaccggtgccgattgggccgggccgcaatctggat
ccgcaacgaccggaggaatggggcagcagcctccgcgacaccctcggcgctgaaccagcg
tccacggtgattcccgctcctttcgttcaggtccccctgggcatcacggaagaccgcctc
gtgggggctgtggacgtgaccgcctccctgagcagtggcagccccgtgtttcagcccggc
ctgctggcggaagcccaccgtggggtgctgtatgtggacgagctcaacctgttggatgac
ggcatcgtcaatctccttctggccgccgtgggagcgggcgagaaccaggtggaacgggag
gggttgagcctcagccacccctgcaggccgctgttgatcgccacgtataacccagaggaa
gggaacgttcgcgatcacctgctcgaccgctttgccatcgcgctctcagctgatcagctg
gtgagcaccgaacagcgggtggagatcaccaatgcggtgctcagccacggacagtgcagc
cgcagcttcgcggagcgctggaaggaagacaccgatgccctggccacccagctgctgctg
gcccggcaatggctcccggatgtgcagatcagtcgcgagcagatcgaatatctggtcacc
gaagccatccgcggcggcgtggaagggcatcgctctgagttgtatgccgtgcgcgtggcc
aaagcccatgcggccctcagtggtcgcgatcaggtggaggccgatgacctgcaggtggct
gtggctctggtgattgcaccccgcgcctcccagttgccgccaccggatcagcagatggag
ccaccgccgccgcccgagcagcccgacgatcagaccccgccaccaccgccggaccccggt
gagcagaacagcgacgacacgcctcccccaccggagggatccgctgacgacgacaacgat
ccaccggaagacagcagcgacgacaacgacagcgaagacgacgacagcaacgatgacgag
gactcggagcaggacgaggcaccaccctcggtgcccgaagagttcatgctggatcccgag
gcggtagcgatcgatcccgacctgctgctgttcaatgccgccaagagcaaaagcggcaac
agtggcagccgttcggtggtgctcagtgacagccggggccgttacgtgaaaccgatgctc
ccccgcgggccggtgaggcgcatcgccgttgatgccacgctgcgagcggctgcgccttac
caaaaagcacgccgagcacgccaaccggagcgcaccgtgatcgtggaggaatcagacctg
cgcgccaagctgctgcagcgacaagctggagcgttggtgatcttcctggtggatgccagt
ggatcgatggccctgaaccgaatgcagagcgccaagggagcggtgatcaggctgctcact
gaggcctatgaaaaccgcgatgaagtggctctgattcccttccgcggcgatcaggccgaa
gtgttgctgccgcccacccgctcgatcacggccgcccgccggcggctggaatcgatgccc
tgcggcggcggctcccccctcgcccatgggctcacccaggcggctcgcgttggtgccaat
gctttggccacgggcgatcttgggcaagtggtggtggtggcgatcacggatggacgcggc
aacgtccctctcagcacgtccctgggccagccggagcttgaaggagaggagaagcccgat
ctcaagcaggaggttctcgatgtggcgggtcgctaccgcatgcttgaaatcaagctgctg
gtgatcgacaccgagcgcaagttcattggcagcggcatgggcaaagaccttgccgaagcc
gcgggtggcaaatacgtgcagctgcccaaggccagcgatcaggccattgccgctgtggcc
atggaggcgatcaattcggtgacctga

DBGET integrated database retrieval system