KEGG   Synechococcus sp. WH7803: SynWH7803_0259Help
Entry
SynWH7803_0259    CDS       T00524                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syx  Synechococcus sp. WH7803
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
283093..283602
Genome map
AA seq 169 aa AA seqDB search
MSASLADQACSLAVALGANRPSAAGSPQQTLIDVRPQLEQLLCDWAQISLSRISCSWSPL
LETAPVGGPPGQPMYCNAVLLIRGVPGAPDAEAALALLDRLQALEAQYGRDRDREVRWGP
RSLDLDLLFWGDWRLEHPRLVLPHPRLHLRSFVMEPLLAAMQRSTHWRS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccagtctcgctgatcaggcttgttctctggcagtggcgttgggggccaatcgt
cccagtgctgcgggcagcccccaacagaccctgatcgatgtgcgcccacagctcgaacaa
ttgttgtgcgactgggctcagatcagcctgtcccgcatcagctgctcatggtcgcccttg
ctggagacggctccggtgggagggccgcccggtcagccgatgtactgcaatgccgtgctc
ctgatccgcggtgtgcctggtgctccagatgcggaggcggcgctggcgttgctggatcgt
ctccaagcgctggaggcgcagtacggccgcgatcgcgatcgcgaagtgcgttgggggccc
aggtcgctggatctggatctgctcttctggggtgactggcggctggagcatccccggctg
gtgttgccgcatccacgcctgcatctccgctctttcgtgatggaacctttgctcgcggcc
atgcagcgttccacgcactggcgctcctga

DBGET integrated database retrieval system