KEGG   Synechococcus sp. WH7803: SynWH7803_0259Help
Entry
SynWH7803_0259    CDS       T00524                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syx  Synechococcus sp. WH7803
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SynWH7803_0259 (folK)
Enzymes [BR:syx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SynWH7803_0259 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
283093..283602
Genome map
AA seq 169 aa AA seqDB search
MSASLADQACSLAVALGANRPSAAGSPQQTLIDVRPQLEQLLCDWAQISLSRISCSWSPL
LETAPVGGPPGQPMYCNAVLLIRGVPGAPDAEAALALLDRLQALEAQYGRDRDREVRWGP
RSLDLDLLFWGDWRLEHPRLVLPHPRLHLRSFVMEPLLAAMQRSTHWRS
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccagtctcgctgatcaggcttgttctctggcagtggcgttgggggccaatcgt
cccagtgctgcgggcagcccccaacagaccctgatcgatgtgcgcccacagctcgaacaa
ttgttgtgcgactgggctcagatcagcctgtcccgcatcagctgctcatggtcgcccttg
ctggagacggctccggtgggagggccgcccggtcagccgatgtactgcaatgccgtgctc
ctgatccgcggtgtgcctggtgctccagatgcggaggcggcgctggcgttgctggatcgt
ctccaagcgctggaggcgcagtacggccgcgatcgcgatcgcgaagtgcgttgggggccc
aggtcgctggatctggatctgctcttctggggtgactggcggctggagcatccccggctg
gtgttgccgcatccacgcctgcatctccgctctttcgtgatggaacctttgctcgcggcc
atgcagcgttccacgcactggcgctcctga

DBGET integrated database retrieval system