KEGG   Synechococcus sp. WH7803: SynWH7803_0344Help
Entry
SynWH7803_0344    CDS       T00524                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
syx  Synechococcus sp. WH7803
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SynWH7803_0344 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SynWH7803_0344 (pyrB)
Enzymes [BR:syx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SynWH7803_0344 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
365807..366835
Genome map
AA seq 342 aa AA seqDB search
MSAWTHRHILDLSTFSREDYAAVLELAHRFSAMPVTGARRLPALQGRLVATLFFEPSTRT
RSSFELAAKRLSADVSSFSPSSSSLSKGESLLDTARTYVAMGADVLVVRHRCTGVPRQLA
EALERTGERTVVLNGGDGLHSHPSQGLLDLYTLAQHFNPSHPLPEALRGRRIVIVGDVLH
SRVARSNLWALTACGADVILCGPPSLVPEAFAQFVAQPPPGQASDPVADRGALTVVRNLD
DALAGADAVMTLRLQKERMRQHMLTSLDRYHRDFGLSHERLQVCQVPIPVLHPGPVNRGV
EMSGALLDDLSANRVEDQVRNGIPIRMALLYLMAAAESPLSL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcgtggacccaccgccacatcctcgatctctccaccttctccagggaggattac
gcggctgttctggagctggcccatcgcttcagcgcgatgcccgtcaccggcgcgcgtcgg
ctgccggcgctccaggggcggctggtagccacactcttctttgaaccaagcacccgcacc
cgcagcagctttgagctggcagccaagcgcttgtctgccgacgtctccagcttctcgccc
tccagcagttcgctcagcaagggagagtccctgctcgatacagctcgcacctatgtggcc
atgggcgccgatgtgctggtggtgcgccaccgctgcacaggcgtgcccaggcagttggct
gaagccctcgaacgcacgggtgagcgcaccgtggtgctcaatggcggcgatggcttgcac
agccatccaagccaggggctgctcgatctctacaccctggcgcagcatttcaaccccagt
cacccgttgccggaagccctgcgcggacgccgcattgtgatcgtgggcgatgttctccac
tccagagtggcgcgctccaatctctgggccctcaccgcctgtggcgcggatgtgattctc
tgcggtccgccaagccttgttcctgaggcctttgcgcagttcgtagcccagccgccgcct
ggacaagcctcagaccccgttgctgatcggggcgcattgaccgtggtgcgcaatcttgat
gatgcgctggccggagccgatgcggtgatgaccctgcgtttgcagaaggagcgcatgcgt
cagcacatgctcaccagcttggatcgctatcaccgcgactttgggctcagccatgagcga
ctgcaggtctgccaggttcccattcctgtgctccaccctggcccggtgaaccggggtgtg
gagatgagcggtgcccttctcgatgatctgagcgccaatcgtgtggaggatcaggtgcgc
aatggcatcccgatccggatggcactgctttatttaatggcggctgcggagtctccgctt
tcgctctga

DBGET integrated database retrieval system