KEGG   Synechococcus sp. WH7803: SynWH7803_0517Help
Entry
SynWH7803_0517    CDS       T00524                                 

Gene name
psbT
Definition
(GenBank) Photosystem II reaction center T protein
  KO
K02718  
photosystem II PsbT protein
Organism
syx  Synechococcus sp. WH7803
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    SynWH7803_0517 (psbT)
Photosynthesis proteins [BR:syx00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    SynWH7803_0517 (psbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(518240..518335)
Genome map
AA seq 31 aa AA seqDB search
MESFAYILILTLAIATLFFAIAFRDPPKIGK
NT seq 96 nt NT seq  +upstreamnt  +downstreamnt
atggaaagctttgcttacatcctcatcctcacccttgcgattgccactctcttcttcgcc
atcgccttccgcgaccccccgaagatcggcaagtag

DBGET integrated database retrieval system