KEGG   Synechococcus sp. WH7803: SynWH7803_0547Help
Entry
SynWH7803_0547    CDS       T00524                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
syx  Synechococcus sp. WH7803
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SynWH7803_0547 (glpK)
Enzymes [BR:syx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SynWH7803_0547 (glpK)
Exosome [BR:syx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SynWH7803_0547 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(551022..552527)
Genome map
AA seq 501 aa AA seqDB search
MVRSPLLLALDQGTSSSRAVLFDEQGQAVASASAPLNIHYPADGWVEQTPMEIWASQRQA
MARLEQTISAEQRQAVVACGITNQRETTILWRRSDGAPCGPALVWQDGRTADVCAAWKRE
GLERDWRTRTGLMLDPYFSASKIQWLLQNHDEASRAAAQGDLCFGTVESWLLWHLSGARR
HCSDMSNASRTLLMDLEQRQWVPAFCDHIGLPSNALPDLVPCRGDFGTIASDCPFAGVPI
CALLGDQQAATLGQLCLEPGEAKCTYGTGAFLVINTGSEIKRSDAGLLSTLGWTDDQGTP
TYCLEGSLFNAGTVVQWLRDGLEIIDSAEEVNRLALTVDDAAGVMLVPAFTGWGTPHWDP
QARGLLMGLTRDSRRGHIARAALEGIALSVAGLVRLAEQASGHELGELAVDGGAAASDPL
LQAQADSTGLRVRRPSQLESTARGVALLAGLQCDVVSDLQSLLPQREQNTQLFMPRLDLD
QRQTWLRRWDDAVSRSLHWHE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttcgttcgcccctcctgctggcactggatcaaggcaccagcagttcacgcgctgtt
ttgtttgacgagcagggacaggcggtggccagcgcctctgcccccttgaacatccactac
cccgccgatggctgggtcgaacagacgccaatggagatctgggccagtcagcgccaggcg
atggcgcgtctggagcagacgatcagcgcagagcaacgccaggcggtggtggcctgtggc
atcaccaatcagcgcgaaaccaccatcctttggcgccgcagcgacggcgctccctgcgga
cccgccctggtctggcaggacgggcgcaccgccgatgtgtgcgcagcctggaaaagggag
ggactggaacgggactggcggacacgcacaggcctgatgctcgacccctacttcagcgcc
agcaagatccaatggctgctccaaaaccacgacgaagcctccagagcagccgcccaggga
gacctctgcttcgggacggtggaaagctggttgctgtggcacctgagcggggcccgtcgc
cactgctcggacatgagcaatgccagtcgcaccctgctcatggatcttgagcaacgccaa
tgggtacctgcgttttgtgaccacatcgggctccccagcaacgccctgcctgatctggtg
ccctgtcgcggcgacttcggaacgatcgccagcgactgccccttcgccggagtgccgatc
tgtgcactcctgggcgaccagcaggcggcaacactcggacaactctgtttggaaccagga
gaagccaaatgcacctacggaaccggtgctttcctggtgatcaacaccgggagcgaaatc
aagcgcagtgacgctgggctgctgagcaccctcggctggaccgatgaccagggcactccc
acgtactgcctggagggcagccttttcaatgccggcaccgtcgtgcagtggctgcgtgat
ggcttggagatcattgattcagccgaggaggtgaaccgcctggccctcaccgttgacgac
gctgcgggggtgatgctcgtcccagccttcaccggctggggcaccccccattgggatccc
caggcccgcggcctgctgatgggcctcacccgcgacagccggcggggacacatcgcccga
gccgcgctcgagggaattgctctctccgtggcggggttggttcgactggccgagcaggcc
agcggccatgaactgggtgaactggccgtcgatggcggtgctgccgcttcagatcccctg
cttcaggcccaagccgacagcacagggctgcgcgtgcggcgcccttcccaattggagagc
accgcacggggcgtcgccttgctggcaggccttcagtgcgatgtggtttccgatctgcaa
agccttcttccccagcgtgagcagaacacccaactgttcatgcctcgccttgatcttgat
cagcgacagacctggttgcgacgctgggatgacgccgtttcacggagcctccattggcat
gaatga

DBGET integrated database retrieval system