KEGG   Synechococcus sp. WH7803: SynWH7803_0560Help
Entry
SynWH7803_0560    CDS       T00524                                 

Definition
ARD/ARD' family protein (methionine salvage pathway)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
syx  Synechococcus sp. WH7803
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SynWH7803_0560
Enzymes [BR:syx01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     SynWH7803_0560
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     SynWH7803_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(566523..567065)
Genome map
AA seq 180 aa AA seqDB search
MSELSIYSEQGGEPVFSTLDSARIQHELSLRGIAFDRCASKAEIALDADQADILSTYAEE
IHRIQALGDYPTVDAIRMKPDHPDRQALRQKFLSEHTHAEDEVRLFVEGRGLFCLHIKSE
VLQVTCETNDWISVPAGTRHWFDMGEKPYFCAIRFFNNPNGWVANFTNDPIAERFSKLRD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctgagcatctattccgaacagggaggcgagccggttttcagcacgctggat
tcggcgcgcatccaacacgagctcagcctgcgaggcattgcgtttgatcgctgcgcgagc
aaagcggagatcgcgcttgatgccgatcaggccgacattctctcgacctacgccgaggag
attcaccggatccaggccctcggcgattaccccaccgttgatgccatccgcatgaagcct
gatcatccggatcgccaggccctgcgccaaaagtttctcagtgaacacacccacgccgaa
gacgaggtgcgcctgttcgtggaaggacgcggcctgttttgcctgcatatcaaaagcgaa
gtgcttcaggtgacgtgcgaaaccaacgattggatcagcgtgcctgctggaacccggcac
tggtttgacatgggagaaaagccctatttctgcgcaattcgttttttcaacaaccccaac
ggctgggtcgccaacttcacaaacgatccgattgctgagaggttttcaaaattgcgcgac
taa

DBGET integrated database retrieval system