KEGG   Synechococcus sp. WH7803: SynWH7803_0658Help
Entry
SynWH7803_0658    CDS       T00524                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
syx  Synechococcus sp. WH7803
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
658725..659483
Genome map
AA seq 252 aa AA seqDB search
MTSTLPVSTNGNGSASQNAKLSALQSRVSDRIRARLRERDVSFLANDNVADHLLPGELDA
LQVEVADRVRDLLHSLVIDIENDHNTAETAERVAKMYLHEVFKGRYHQQPKVASFPNVKR
LDEIYTVGPITVRSACSHHLVPIMGNCWIGIKPGERVIGLSKFTRVADWVFSRPHIQEEA
VMILADEIERLCEPQGLGIIIKAQHYCMKWRGVKEPQTSMVNSVVRGDFRHDPSLKQEFF
ELVRQQEALLST
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaactctccctgtctccacaaacggcaacggttccgccagccagaacgcaaag
ctttccgcgcttcaatcccgtgtgtctgatcggattcgtgcacgattgcgggaacgggat
gtgtcgttccttgccaacgacaatgtggcagaccatctccttcccggagaacttgatgcc
ttgcaagttgaggtggcggaccgtgttcgcgatttgctgcattctcttgtgatcgacatc
gagaatgatcacaacaccgccgagacggccgagcgtgtggcgaagatgtacctgcacgag
gtgttcaagggccgatatcaccagcagccgaaagtggccagcttccccaatgtgaagcgc
ctggatgaaatttataccgttgggcccatcacagtgcgctcggcctgttctcaccacctg
gtgcccatcatgggcaactgctggattggtatcaagcccggagagcgagtcatcggtctg
tcgaaattcacccgcgttgctgattgggtgttttcaaggcctcacatccaagaagaggcg
gtgatgatccttgccgacgagatcgagcgactgtgcgaaccccagggcttgggcatcatc
atcaaagctcagcactactgcatgaaatggcggggtgtgaaagagccccaaaccagcatg
gtgaattcagtggttcgtggtgatttccgccatgacccaagcctgaagcaggaattcttt
gaactcgtgcgtcagcaagaagcgcttctcagcacctga

DBGET integrated database retrieval system