KEGG   Synechococcus sp. WH7803: SynWH7803_0732Help
Entry
SynWH7803_0732    CDS       T00524                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syx  Synechococcus sp. WH7803
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SynWH7803_0732 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynWH7803_0732 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SynWH7803_0732 (trpA)
Enzymes [BR:syx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SynWH7803_0732 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
723747..724550
Genome map
AA seq 267 aa AA seqDB search
MQPSSRIAEVFAQTAREQRLALMPFIVAGDPNLETTADILLSLQSNGADVVELGIPYSDP
LADGPVIQSAAYRALAQNTTPSNVLTMLRGLRDRLTMPVVLFTYSNPLLNRGAEAFFAEA
ADAGVAGLVVPDLPLEEAERLSPLAAEQGLDLVLLVAPTTPGDRRRRIATSSRGFTYLVS
VTGVTGERASLQDRVAELVLSLKGLEAGPVAVGFGISGADQVRQVREWGADGAIIGSALV
KRIAAAQPGCAAAEAGEFCRELRKAAG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcagccttcgtcacgaatcgccgaggtcttcgcccagaccgctcgtgagcagcgcctc
gcactgatgcctttcatcgtggctggcgatccgaatctggaaacaacagccgatatcttg
ctcagccttcagtccaatggtgctgatgtggttgaactgggaattccttacagcgatcca
ctggcggatggtccggtgatccaatccgctgcctatcgagcattggctcagaacaccacg
ccgtcgaatgtgctcaccatgctgcgtggtctgcgcgatcgtctgaccatgccagttgtg
ctgttcacttacagcaatcctctgctgaaccgtggtgcagaagcattcttcgctgaggct
gcagatgcaggcgtggctggattggtggtgcccgatcttcccttggaggaggcggaacgt
ttgtctccactcgctgctgagcagggcctggatcttgtgctgcttgtggcccccaccact
ccaggcgatcgtcggcgcaggatcgcaacatccagccgtggatttacttatctggtcagt
gttacaggcgtgaccggtgaacgtgcttctcttcaggatcgcgtagcagagctggtgctt
tcgctaaagggattggaggctggacctgttgcggttggctttggaatttctggggctgat
caggtgcgtcaggtgcgtgagtggggagctgatggcgccatcattggcagtgccctcgtt
aaaagaatcgccgctgcacaaccaggttgtgcagcggcggaagcaggtgaattttgccgg
gagctgcgcaaggcagccggctga

DBGET integrated database retrieval system