KEGG   Synechococcus sp. WH7803: SynWH7803_0756Help
Entry
SynWH7803_0756    CDS       T00524                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
syx  Synechococcus sp. WH7803
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SynWH7803_0756
Enzymes [BR:syx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SynWH7803_0756
Exosome [BR:syx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SynWH7803_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(738615..740900)
Genome map
AA seq 761 aa AA seqDB search
MTNTVLEWMVEDAQRLAECRHDHPFAVLGPQPQEDGTWVLRAWMPEAEGVTLLLGDQEMG
MSTPHHPWIFEASVAHDPGCAYRLRVHRGGITHEQHDPWAFRQDWMGEMDRHLFAEGNHH
HIWRRMGAHHCEREGIPGVMFCLWAPHARSVSVIGDLNSWDGRHHPMQQRLGGIWELFVP
GLAEGQLYKYEIRTQEGHCYQKADPYGFQHEVRPDTSSVVSHLDGFHWTDTDWIQKRDSS
NPLDQPIAVYEMHLGSWIHAAADEPFIEADGTPRAPVPAADLKPGARLLTYPELADRLIP
YVKERGFTHIELMPITEHPFDGSWGYQVTGWYAPTSRYGTPDEFRAFVDRCHAEGIGVII
DWVPGHFPRDSHGLAFFDGCHLYEHADPRIGEHKEWGTLIFNYSRNEVRNFLVANLVFWF
DQFHIDGIRVDAVASMLYRDYLRPDGEWLPNEHGGRENTEAVQFLQQANHVLFQHFPGAL
SIAEESTTWPMVTQPTDIGGLGFNLKWNMGWMHDMLDYFELDPWFRQFHQNNITFSIWYT
YTENFMLALSHDEVVHGKSNLLHKMPGDDWQKYANTRALLAYMWTHPGKKTIFMGMEFGQ
RAEWNVWGDLQWDLLNYEPHQGVQRMVDDLNGLYKSEPALWRDDFDQYGFQWIDCNDNRH
SVISFMRRESTSGTWLVVVANFTPQSHSHYRVGVPLAGYYEEIFNTDASKYGGSNLGNMG
GKPTEEWGIHGYENSLDLCLPPLSLMVFKHDPKKSLNPVQE
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacactgttctcgagtggatggttgaggacgcccagcgattggccgagtgccgt
cacgaccatcccttcgccgtcctcgggccccaacctcaggaggatggcacctgggttctc
cgcgcatggatgcctgaagcggagggtgtcaccttgctcctgggagaccaagagatgggg
atgtcgactccccaccatccctggatcttcgaagcgtccgtcgcccatgaccccggatgc
gcctaccgcttacgggtgcaccgcggaggcatcacccacgaacagcacgacccctgggcg
ttccgacaggactggatgggcgagatggatcgccatctcttcgccgaaggcaaccatcac
cacatctggcgccgcatgggtgcccatcactgcgagcgggaagggatcccgggggtgatg
ttctgcctttgggctccgcatgcacgcagcgtgagtgtgatcggcgatctgaactcctgg
gatggccgtcaccaccccatgcagcagcgcctgggaggaatctgggagctcttcgttccc
ggcctggcggagggacagctctacaaatatgaaatccgcacccaggagggccactgctat
cagaaggccgatccctacgggttccagcatgaggttcgtcccgacaccagttcagtggtg
agccacctggatggcttccattggactgacacggactggatccagaagcgcgacagcagc
aatcccctcgatcaaccgatcgcggtgtacgagatgcacctcggcagttggatccacgcg
gccgccgacgagcccttcatcgaagccgatggcaccccccgagctcctgttcccgccgct
gacctcaaacccggtgctcggctgctcacctatccggagcttgccgatcgcctgattccc
tacgtgaaggagcggggcttcacccacatcgagctgatgccgatcaccgagcatcccttc
gatggctcctgggggtatcaggtcaccggttggtacgcgcccacgagccgctacggcaca
cctgatgaattccgtgcctttgtcgaccgctgccatgctgagggcatcggcgtgatcatc
gattgggtccctggccacttcccgcgcgacagccatggcctcgccttcttcgacggttgc
catctctatgagcatgccgacccaagaattggcgaacacaaagaatgggggacgctgatc
ttcaattacagccgcaatgaggttcgcaactttctggttgccaacctggtgttctggttc
gatcagttccacatcgatggcatccgtgtggacgctgttgcatcgatgctgtatcgcgac
tatctgcgcccggatggcgaatggctccccaatgaacacggcggcagggaaaacaccgaa
gcggtgcaattcctgcagcaagccaatcacgtgctcttccagcacttcccaggagccctc
tcaatcgccgaggaatccaccacatggcccatggtcacgcagcccacggacatcggtggt
cttggcttcaacctgaaatggaacatgggttggatgcacgacatgctcgattatttcgag
cttgatccctggttccgccagttccatcagaacaacatcacattttccatctggtacacc
tacacggaaaatttcatgctggccctcagccacgatgaggtggtgcatggcaagagcaat
cttctgcacaaaatgcctggagatgattggcagaaatacgccaacaccagagcactactg
gcctacatgtggacgcacccgggcaagaaaaccatcttcatgggaatggagtttggccag
agggctgaatggaatgtttggggagatctgcaatgggatcttctcaactacgaaccgcat
caaggtgtccagcgcatggtcgatgacctcaatgggctgtacaaatcagagcctgccctc
tggcgtgatgactttgatcaatacggcttccaatggattgactgcaacgacaaccgccat
tccgtgatcagcttcatgcgccgggaaagcacaagcggcacctggctcgtggttgtggcc
aacttcacgccgcaaagtcattctcactatcgcgtcggcgttcctctggctgggtactac
gaagagatcttcaacaccgatgccagcaaatacggtggcagcaacctgggcaacatgggc
ggaaagcccactgaagagtgggggatccacggctacgaaaactctctcgacctttgcctg
ccgcccttgagcctgatggtgttcaagcacgatcccaaaaagagcctcaatccagttcag
gagtga

DBGET integrated database retrieval system