KEGG   Synechococcus sp. WH7803: SynWH7803_0763Help
Entry
SynWH7803_0763    CDS       T00524                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syx  Synechococcus sp. WH7803
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:syx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syx00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:syx00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syx00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:syx00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:syx00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
749052..749942
Genome map
AA seq 296 aa AA seqDB search
MAEPCVLGVDIGGTALKLGLFSLDGTLLAELQRPTPQPATPGSVCMELVEAIDTLDPQRT
AERVGIGLPGPMDAAARVARVCINLPGWEEVPLAAWLEPRLKRRVTLANDGNCALVGEAW
KGAARGCQDVVLLTLGTGVGGGVMLGGTLFTGHNGAAAEPGLITLDPDGPPCNSGNQGSL
EQFASISGLGRLSAKAPALLAEAASRGDAEALAIWAEYGRLLGIGITSLVYVFTPQRVLV
GGGLAGASPHFLPAVRQEVAQRVQAVSREGLRIEACALGNGAGRLGAARLALQRLR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccgtgtgttctgggagttgatatcggtggaaccgctctcaagctcggcctg
ttcagcctggatggcaccttgctggctgaactccagcgacccacgccgcaaccggcaaca
cccggatccgtgtgcatggaactggtggaggccatcgacacgctcgatccgcagaggacg
gccgaacgggtggggattgggctgcctggaccgatggatgcagcggcccgggtggcgagg
gtgtgcatcaatctgcctggatgggaggaggttcccctggctgcgtggctggagccacgc
ctcaagcgcagggtcacgttggccaatgacggcaactgcgccctcgtgggagaggcctgg
aagggggctgctcgaggttgtcaggatgtggtgcttctcaccttgggaacgggggttggc
gggggggtgatgctcgggggcacgttgttcacgggccacaacggtgccgctgcagagcct
ggtttgatcaccctcgacccggacgggcctccctgcaacagcggcaatcaagggtcgctc
gaacaattcgccagcatcagtggcctggggcgtctcagcgccaaggcgccagcccttctc
gctgaagcggcgtcgcgcggggatgctgaggctctggcgatctgggctgaatacggccgc
ctgctggggatcggcatcacatcgctggtgtacgtgtttacaccacaacgcgtgctggtg
ggcggagggctggctggagccagtccccattttcttcccgcggtgcgccaagaggtggct
cagcgggtgcaggccgtttccagggagggactgcgcatcgaagcctgtgccctgggaaat
ggagccggtcgtctcggcgcagctcggctcgctttgcagcgcttgcgctga

DBGET integrated database retrieval system