KEGG   Synechococcus sp. WH7803: SynWH7803_0774Help
Entry
SynWH7803_0774    CDS       T00524                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00010  Glycolysis / Gluconeogenesis
syx00052  Galactose metabolism
syx00500  Starch and sucrose metabolism
syx00520  Amino sugar and nucleotide sugar metabolism
syx00521  Streptomycin biosynthesis
syx01100  Metabolic pathways
syx01110  Biosynthesis of secondary metabolites
syx01120  Microbial metabolism in diverse environments
syx01130  Biosynthesis of antibiotics
syx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynWH7803_0774 (glk)
   00052 Galactose metabolism
    SynWH7803_0774 (glk)
   00500 Starch and sucrose metabolism
    SynWH7803_0774 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SynWH7803_0774 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SynWH7803_0774 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SynWH7803_0774 (glk)
Enzymes [BR:syx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SynWH7803_0774 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CAK23200
CyanoBase: SynWH7803_0774
CYORF: SynWH7803_0774
UniProt: A5GJT5
Position
complement(760936..762012)
Genome map
AA seq 358 aa AA seqDB search
MAAKTFLAGDLGGTKTLLALYSESEEGLNKIHSHRYVSAEWSDLESMLGDFLKTLPQGLS
KPETSCIAVAGPVQNGTAKLTNLPWSMSEASLCKATGLQRLELVNDFAVLIHGLPHFSAS
QQVVLQTGSGRDAPAAAGQDGGAVAILGAGTGLGMARGLPAARGWQALPSEGGHREFAAR
TEDEWHLAQWMRSTLDLDRLSIERVVSGTGLGHVMCWLLSAQEHSDHPLQGKAKAWTTLP
AEHPDHEDLPAHTSRAAASGDPLAQAAMTLWLGAYGSAAGDLALQELCTGGLWIGGGTAE
KVIDGLRSSQFLEPLRRKGRFRPLIESLTIRAVTDQEAGLFSAACRARDLAESGGTLA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaaacatttttggccggtgatctcggaggcaccaagacccttctggccctt
tacagcgaatccgaggaggggctgaacaagattcactcccatcgctacgtctcggcggag
tggagcgacctggagtcgatgcttggcgatttcctcaagacgttgcctcaaggtctctcc
aaaccggaaaccagctgcatcgccgtggccggaccggtgcagaacggcacggcaaagctc
acgaacctcccctggagcatgagtgaggcctcgctgtgcaaagccacagggctgcaacgc
ctggagctggtcaacgactttgctgtgctcatccatggcctgccccacttcagtgcgtca
cagcaggtggtgctgcagaccggaagcggccgagacgcgccagcagcagccggccaagac
ggcggggccgtcgccattctcggtgcaggcactggcctgggaatggcccgcggccttccg
gcagccagaggctggcaggccttgcccagcgagggaggtcaccgcgaattcgcagcgcga
accgaagacgaatggcacctggcccagtggatgcgcagcactctcgatctcgatcggctg
tccatcgaacgggtggtcagcggcacgggacttggccacgtgatgtgttggctgctctcc
gcgcaggagcacagcgatcaccccttgcaaggcaaggcgaaagcctggacgacgctgcca
gcagagcacccggatcatgaagacctgccagcccacaccagtcgggccgccgcatcaggg
gatcctctggcccaggccgcgatgacgctatggctgggagcgtatggctctgccgcaggg
gatctggcccttcaggagctctgcactggtggactctggatcggcggtggcacagcggag
aaggtcatcgatggcctgcgctcctcgcagtttctcgagcctctgcgccgcaaaggacgc
ttcaggcctctgatcgagagtctcaccatccgggcggtgactgatcaggaagcgggattg
ttcagtgcggcctgcagagcgcgtgatctggcggagtcgggtgggacactggcctga

DBGET integrated database retrieval system