KEGG   Synechococcus sp. WH7803: SynWH7803_0779Help
Entry
SynWH7803_0779    CDS       T00524                                 

Definition
muramidase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
syx  Synechococcus sp. WH7803
Brite
Enzymes [BR:syx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SynWH7803_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(765098..765721)
Genome map
AA seq 207 aa AA seqDB search
MGALSVGLVMTLGTGIQAERAATRVDQAQVVAEALRSQDRRERSKDLKATPYTITPERRA
LLNTIRYAEGTWKDGHDLGYRTLYGGGLFQDLSRHPERVVVKRYTSAAAGAYQFLPSTWQ
ETARSLNLPSFAPNHQDQAALHLVNKRGALQEVDRHGLTRTAMNRLAPEWASFPTHAGLS
AYGQPVKSHAELLAFYESNLLELRQGT
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggagccctcagcgtgggtctggtgatgacgctggggacgggcatccaggctgaacgc
gccgcgacgcgggtggatcaggcccaagtcgtggccgaggcgcttcgcagccaagatcgg
agagagcgctcaaaggatctcaaagccactccgtacaccatcactcccgagcgcagggcc
cttctcaacaccatccgctacgccgaaggaacctggaaggacggccatgaccttggctat
cgcaccctctacggaggcgggctttttcaggatctatcccgtcatcccgaacgggtcgtc
gtgaagcgctacaccagcgcggccgcgggcgcttaccagttcctgcccagcacctggcag
gaaacggcccgaagcctcaaccttcccagcttcgctcccaaccatcaagaccaggcggct
ctgcacttggtgaacaagcgcggcgccctgcaggaggttgaccgccatggcttgacccga
accgccatgaaccgtctggcaccggagtgggcctcctttcccacccatgcagggctcagt
gcctatggccaaccggtgaagagccacgctgaactcctagccttctacgaaagcaatctg
ctcgagctgcgccagggcacctga

DBGET integrated database retrieval system