KEGG   Synechococcus sp. WH7803: SynWH7803_0794Help
Entry
SynWH7803_0794    CDS       T00524                                 

Gene name
rbsK
Definition
ribokinase family sugar kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
syx  Synechococcus sp. WH7803
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SynWH7803_0794 (rbsK)
Enzymes [BR:syx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SynWH7803_0794 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(781483..782316)
Genome map
AA seq 277 aa AA seqDB search
MDLNDLPDLSALNLAVIGHQEWVTFLEVDALPQPGRISRACRSLEEPAGAGAVVAVQLAR
LTGRRVLFFTALGSDAIGQRSEQRLRELGVEPVVAWRDTPSRRGISLMDPGGDRAITVIG
ERLTPCAEDDLGWERLASCDGVFVSATDAAGLRLARQARVLTATPRLRLPVLEEASVPLD
ALIGSGLDPSEQLPEGTPEPAPRLRIATEGAEGGLLVPGGRFAPEPLPGPSVESYGCGDS
FAAGVTAGLAAGWAVADAVQLGARCGAACATRFGPYG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcaacgacctgccagacctgtccgccttgaacctggccgtgatcggtcatcag
gaatgggtcacgtttctggaagtcgatgctctgccccagccaggccgcatcagccgggcc
tgccgatccctcgaggaaccggccggcgcaggagctgtcgttgctgttcagctggcgcgt
ctcactgggcgtcgggtgctgtttttcaccgctctcggctccgatgccatcggacaacgc
agtgaacaacgcctcagggagctgggggtggagcctgtggttgcctggcgcgacaccccg
agccggcgtggcatcagcctgatggatcccggcggcgaccgggccatcaccgtgattggg
gaacgcctcaccccttgcgcagaggatgaccttggctgggaacgcttggcgagctgcgat
ggcgtgttcgtgtccgcgaccgatgccgctggcttgcgcctggcccgacaagccagggtg
ctcacagccacgccaaggctgcgtctgccggtgctggaggaggcatcggttccactggat
gccttgatcggcagtggccttgatcccagcgaacagctgcccgagggaacccctgaaccc
gcccccaggctgcgcatcgccacagagggtgctgagggtggtctgttggttcccggaggt
cgctttgccccagagcctctccctggtcccagcgtcgagtcctacggctgcggcgacagc
tttgccgcgggtgtgaccgctggcctggccgcgggctgggcagtggcggatgccgtgcaa
ctcggtgcgcgctgtggtgctgcctgcgcgacgcgtttcggtccctatggctaa

DBGET integrated database retrieval system