KEGG   Synechococcus sp. WH7803: SynWH7803_1040Help
Entry
SynWH7803_1040    CDS       T00524                                 

Gene name
acsA
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syx  Synechococcus sp. WH7803
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:syx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syx00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:syx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:syx00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:syx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
955956..957926
Genome map
AA seq 656 aa AA seqDB search
MSEGSTIESVLKEQRVFAPPIELTQSARIGGMEAYQAMADAARKDPDAFWGDAARRELDW
FTPFEQVLDWSNPPFARWFQGGTTNLSHNCLDRHLHGETANKTALIWEGEPGDVRRFTYR
ELHAEVCKAANALKSMGIGKGDLVALYMPMIPEAAIAMLACARIGAPHSVVFGGFSAEAL
RDRLIDGEAKAVITADGGFRKDKPVSLKPAVDAALAGGACPSVTSVLVVQRTQQPVEMAQ
GRDQWWHALVDGQSSECPAEPMQSEDRLFVLYTSGSTGKPKGVVHTTAGYNLWAHLTFQW
IFDLRDNDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGAPRPSKPGAFWEVIQKHGV
TIFYTAPTAIRAFMKSGRTVPDQFDMSSLRLLGTVGEPINPEAWMWYRDVIGGGRCPIID
TWWQTETGGVMISPLPGATPTKPGSATLPLPGIEADVVDAEGNSVAANEGGYLVVRRPWP
GMMRTVHGNPERFRQSYWEHIRPDDGSHIYFAGDGARRDADGYFWVMGRVDDVINVSGHR
LGTMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFVTLEVEREASDALIAELRAHVGTE
IGPIARPDEIRCSDALPKTRSGKIMRRILRALAAGEDVTGDTSTLEDRSVLDRLRA
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggttccacgatcgaaagcgtgctcaaggagcagcgcgtttttgctccgccc
attgagctcacccagtcagcccggatcggtggcatggaggcctaccaggccatggccgat
gcagccaggaaggatccagacgcgttctggggtgatgcggctcgtcgggaactcgactgg
ttcacaccgtttgagcaggtgctcgactggtccaatcctcccttcgctcgctggtttcaa
gggggcaccaccaacctttcgcacaactgccttgatcgccatcttcacggtgagacggcc
aacaagacggccctgatctgggaaggggagcccggcgatgtccgccgcttcacctaccga
gaactgcacgctgaggtgtgcaaggcggccaatgcgctcaaatccatgggcattggcaaa
ggggatctggtggccctctacatgccgatgattccggaggcggcgattgccatgctggcc
tgtgcccgcatcggcgctccccactcagtggtctttggtggcttctccgcagaagcgctt
cgagaccgcctgatcgatggagaggcgaaggccgtgatcacggctgacggtggcttccgc
aaggacaagcccgtttcactgaaacctgccgtcgatgccgccctggccggcggtgcctgt
ccatcggtgacctccgtgctggtggtgcagcgcacccaacagccggtggagatggcccag
ggccgcgaccagtggtggcatgcgctcgtggatggccagtccagcgaatgcccagcggag
ccgatgcagagcgaagatcggctcttcgtgctttacacgtctggatccactggcaaaccc
aagggggtggtgcacaccaccgcgggatacaacctctgggcccacctcacgtttcagtgg
atctttgatctccgcgacaacgacgtgtactggtgcacagcggatgtgggctggatcacc
ggtcacagctacatcgtgtatggcccgttgtcgaacggggccaccacagtgatgtacgag
ggtgcgccacgaccttcgaagcctggggcgttctgggaggtgatccagaagcacggggtc
acaatcttctacaccgctcccacagcgatccgggcgttcatgaagagcggccgaaccgtg
ccggatcagttcgacatgagcagcttgcgattgctcggaaccgtcggtgaacccatcaac
cctgaagcctggatgtggtacagggatgtgatcggtggtggccgctgtccgattattgac
acctggtggcagaccgaaaccggcggcgtgatgatcagccctcttcctggggccaccccg
accaagcctggctcagccaccctcccgcttcctggaatcgaagccgatgtggtggacgct
gaaggcaacagtgtggcggccaatgaggggggatatctggtggtgcgtcgtccctggccc
gggatgatgcgtacggtgcatggcaatccagagcgattccgtcagagctactgggagcac
atccgtccagacgatggcagccacatctacttcgctggtgacggtgcgcgtcgcgatgcg
gacggttacttctgggtgatgggacgcgtggacgacgtcatcaatgtgtcgggccaccgt
ctcggcaccatggaaatcgaatcagccctggtcagtcaccctgcggtggcggaggccgct
gtggtcgggcgtcctgacgatctcaaaggcgagggcattgtggccttcgtcacccttgag
gtggagcgcgaagccagtgatgcactgatcgctgaattgcgggctcatgtgggaaccgaa
atcggcccgatcgctcgccctgatgaaatccgctgcagtgatgcccttcccaaaacgcgc
agtggcaagatcatgcgccggattctcagggcactggcagctggggaggatgtgactggt
gacaccagcaccctggaagatcgctccgtgctggatcgtttaagggcctga

DBGET integrated database retrieval system