KEGG   Synechococcus sp. WH7803: SynWH7803_1365Help
Entry
SynWH7803_1365    CDS       T00524                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syx  Synechococcus sp. WH7803
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:syx00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1257952..1258881)
Genome map
AA seq 309 aa AA seqDB search
MTAPVCVTAPAKINLHLEVLGLRADGFHELAMVMQSIDLQDQLHCENTSDGSISLRCDAS
ELSCGEDNLIVRAARLLRERSGFSELGARMHLKKHIPIGAGLAGGSSDGAAALVALNELW
GLSLDASQLERFAAELGSDMPFCVAGGTQLCFGRGERLEPLPPLEAQLGILLVKDPDVSV
STPWAYSECRRQRGSTYLQDEAAFEARREALRAAQWLHPLGGEAPPLRNDLQTVVEPLTP
SVRDALQCLASLPNCLQAAMSGSGPSCFALFHNRGEADRAKDQVQTQLDQLGLRSWSCSL
IPHGVKLMA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacggctccggtctgcgtcactgcacccgccaagatcaatttgcatcttgaggtgctt
ggcctgcgtgccgatggttttcacgagctggccatggtgatgcagagcatcgaccttcag
gatcagctgcattgcgaaaacacctcagacggaagcatttccctgcggtgtgatgcttct
gaactcagttgtggtgaagacaacctgattgtccgcgctgcccgattgctcagggaacgg
tcaggtttcagtgaactgggagcacggatgcatctgaaaaagcacattccaatcggtgca
ggactggcgggtggttccagcgatggagcggcggctcttgtggcactcaatgagctctgg
gggttgagcctggatgcaagccaactggagcgttttgctgctgagctgggctctgatatg
ccgttttgcgttgccggtgggacacaactgtgctttggacgcggtgaacgactggaacct
ctgccgcctttggaggctcagctagggattcttcttgtgaaagatcccgacgtgagtgtg
tcgactccctgggcgtacagcgagtgccgccgccaacgtggcagcacctatctccaagat
gaagctgcatttgaagcacgtcgtgaagcgctcagggcggcgcagtggctgcatcccctc
ggtggggaggcgccgccattgcgcaacgatctccaaaccgtggtggagcccctcacgccc
tctgtgcgcgatgcgttgcagtgtcttgcgtccttaccaaactgccttcaggcggcgatg
agcggttcggggcccagttgttttgcgctgtttcacaaccggggtgaggcggatcgtgcc
aaggaccaggtgcagacccaattggatcagttgggtttacgcagttggagttgctcgttg
atcccccacggggtcaagctgatggcatga

DBGET integrated database retrieval system