KEGG   Synechococcus sp. WH7803: SynWH7803_1429Help
Entry
SynWH7803_1429    CDS       T00524                                 

Gene name
carB
Definition
carbamoyl phosphate synthase large subunit (EC:6.3.5.5)
Orthology
K01955  
carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
syx  Synechococcus sp. WH7803
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:syx00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:syx00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1310528..1313851
Genome map
AA seq 1107 aa AA seqDB search
MPRRNDLQRILLLGSGPIVIGQACEFDYSGTQACKALRAEGYEVVLVNSNPASIMTDPEM
ADRTYVEPLTPEVVTRVIERERPDALLPTMGGQTALNLAVALAENGTLERFGIELIGADL
KAIRKAEDRQLFKQAMERIGVKVCPSGIASSMDEAKAVGDSIGSFPRIIRPAFTLGGSGG
GIAYNPEEFDAICKSGLDASPVSQILIEKSLIGWKEFELEVMRDLADNVVIVCSIENLDP
MGVHTGDSITVAPAQTLTDREYQRLRDQSIAIIREIGVATGGSNIQFAINPADGEVVVIE
MNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEILNDITGKTPACFEPTIDYVVTKVP
RFAFEKFRGSPAVLTTAMKSVGEAMAIGRSFEESFQKALRSLETGLSGWGGDRPEPTVQP
AELERSLRTPSPERILSVRAAMIAGRSDTEIHALSNIDPWFLAKLRQLIDAEKRLLHGKR
LDQLSGDALLELKQLGFSDRQIAWQTSSDELAVRQRRSSLAVLPVFKTVDTCAAEFASST
PYHYSTYERPVAQITASGDLTIQAPASEVTSDPRRKLMILGGGPNRIGQGIEFDYCCCHA
SFSAQAQGYCTVMVNSNPETVSTDYDSSDRLYFEPLTFEDVLNVIEVERPAGVIVQFGGQ
TPLKLALPLLRWLNTPEGQSTGTQIWGTTPESIDLAEDREQFEAILRQLDIRQPRNGLAR
SEEEARTVAETVGYPVVVRPSYVLGGRAMEVVYDEHELNRYMNEAVQVEPDHPVLIDQYL
QNAIEVDVDALCDHEGTVVIGGLMEHIEPAGIHSGDSACCLPSVSLGTEALNTIKTWTKA
LALRLNVRGLINLQFAVQRAETGTEKVFIIEANPRASRTVPFVAKATGVPLARIATRLMA
GESLSRVGVLDEPCPPLQAVKEAVLPFRRFPGADSLLGPEMRSTGEVMGWAPNFGMAYAK
AEIAAGDALPTEGTVFLSTHDRDKPALIPVAERLIALGFELIATSGTAQTLAKAGLKVTP
VLKVHEGRPNIEDQIRSGGVQLVINTPIGRQAAHDDRYLRRAALDYSVPTLTTLAGARSA
VEGIEALQSHQLDIHALQDVHAGGESR
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggcggaacgatctgcagcgcattcttctgctgggttccgggccgatcgtgatt
ggccaggcctgtgaattcgactactcaggaacccaggcctgcaaggccctgagagcggaa
ggttacgaagttgttttagtcaattcgaatcccgcttcgatcatgaccgatccggaaatg
gcggatcggacctacgtggaacctctcacccctgaggtcgtcacacgggtgatcgaacgg
gagaggccggatgcactgcttccaaccatgggggggcagacagcactgaacttggctgtt
gcactggcagagaacggcacgcttgagcgtttcggcatcgagttaatcggtgctgacctc
aaggccatccgcaaagcggaggatcgccagctgttcaaacaggcgatggaacgcatcggc
gtgaaggtctgcccttcagggatcgcatcctcgatggatgaagccaaggctgtgggcgac
tccatcggctcattccctcgcatcattcgtccggccttcacgctgggaggcagcggagga
gggattgcctacaacccagaggagtttgatgccatctgcaagagcggccttgatgcaagc
ccggtttcgcaaattctgattgagaagtcactgatcggctggaaggagttcgaactcgag
gtgatgcgcgatctcgccgacaacgtcgtgattgtgtgcagcatcgagaacctcgatccg
atgggagtgcacacgggggactcgatcaccgtggcccccgcccagacgctgacggatcgg
gaataccaacgtctccgagaccagtcgatcgcaatcatccgcgaaatcggcgtagcaacg
ggcggcagcaacattcagtttgcgatcaatccagccgacggcgaggtggtggtcattgag
atgaacccccgcgtcagccgatcatcagcactggccagcaaggccacggggttcccgatc
gcgaagatcgccgcaaagttagccgtcggatacaccctcgacgaaattctcaacgacatc
acaggcaagacaccggcctgctttgagccaacgatcgactacgtcgttaccaaagtcccc
cgcttcgcctttgagaagttccgcggatcgccagctgttctgaccacagcgatgaaatcc
gttggcgaggccatggcgatcggacgatcgtttgaggaatccttccagaaagcgctgcgc
tccctcgagacaggcctttctggttggggaggtgatcgaccggaaccaaccgttcaaccc
gctgaacttgagcggtccctgcgcactccctcccccgagcgaattctcagtgtgcgtgcc
gcgatgattgccgggcggagcgataccgagatccatgctctcagcaacatcgacccctgg
ttcctcgccaaacttcgccaactcatcgatgctgagaaacgactcctgcacggcaagcgt
ctggatcagctctcaggcgatgccctgctcgagttgaaacaactcggtttctctgatcga
caaattgcctggcagaccagcagcgatgaactggcagttcgccagcggcgcagctcgctc
gccgttctccccgttttcaaaactgtcgacacctgcgctgctgaattcgcgtcctcaacg
ccttatcactactccacctacgaaaggcccgtggctcagatcaccgccagcggagatctc
accattcaggcaccagcttctgaagtcacatcagacccgcggcgcaaactgatgatcctt
ggtggtggtccgaacaggatcggccagggcatcgaatttgattactgctgctgtcatgcc
tccttctccgcgcaggcccaggggtactgcaccgtgatggtgaacagcaacccggaaacg
gtttcaaccgactacgacagcagcgatcgtctgtacttcgaacccctcacttttgaggat
gtactcaatgtgattgaagtcgagcggcctgcaggggtgatcgttcaattcggcggtcag
acacctctcaagcttgctcttcctcttctgagatggctcaacacaccggagggacagtcc
accggcacgcaaatttggggaacaacgcctgaatcgatcgatctggccgaagaccgtgaa
caattcgaagccatcttgcggcagctggacattcgtcaaccgcgcaatggcctggcacgc
agtgaagaggaggccagaactgttgcggaaacggtcggctaccccgtggtggttcgccct
tcctacgttctgggcggtcgcgccatggaggtcgtctacgacgagcacgaactcaatcgc
tacatgaacgaagcggttcaagttgaacccgatcatccagtgctcatcgaccaatacctc
caaaacgccattgaggtcgatgtggatgccctgtgcgatcacgagggcacggtcgtgatc
ggggggctgatggaacatatcgaaccagcaggcatccattccggtgattcagcctgctgc
ctcccctccgtctccctggggactgaagcgctcaacaccatcaaaacctggaccaaagcc
ctggcactgcgtctgaacgtgcgtggactgatcaatcttcagttcgccgtgcaacgagcc
gaaaccggtacagaaaaggtgttcatcatcgaagccaatccgagggcgtcacgaaccgtt
ccgttcgtcgccaaagcgacgggagtgccccttgctcgcattgcaacacggctgatggct
ggagaaagtctcagccgtgttggcgtgttggacgaaccatgtccccccctccaagcggtc
aaggaagccgttctccccttcagacgtttcccaggcgcagactcgcttcttggccctgag
atgcgctccacaggcgaagtgatgggctgggctccgaatttcggaatggcttacgccaag
gctgagatcgcagcgggtgatgctctgcccacggaggggacggtgtttctttcaacgcac
gatcgcgataaaccggccttgataccggtggcagagcgtttgatcgcacttggttttgaa
ctgatcgccacctcagggaccgcccagacccttgccaaagcagggctgaaggtcaccccc
gtcctcaaagtgcatgaaggcaggccaaacattgaagaccagatccgctccggaggagtt
cagttggtcatcaacactcccattggccgccaggcagcgcacgatgatcgctatctcagg
cgagccgccctcgactattccgtgcccacactcaccactcttgctggtgcacgctctgcc
gttgaggggatcgaggcactgcagtcccatcaactcgacattcacgccctacaggatgtt
catgcagggggtgagtcccgataa

DBGET integrated database retrieval system