KEGG   Synechococcus sp. WH7803: SynWH7803_1435Help
Entry
SynWH7803_1435    CDS       T00524                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syx  Synechococcus sp. WH7803
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SynWH7803_1435 (tpiA)
   01230 Biosynthesis of amino acids
    SynWH7803_1435 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SynWH7803_1435 (tpiA)
   00051 Fructose and mannose metabolism
    SynWH7803_1435 (tpiA)
   00562 Inositol phosphate metabolism
    SynWH7803_1435 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SynWH7803_1435 (tpiA)
Enzymes [BR:syx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SynWH7803_1435 (tpiA)
Exosome [BR:syx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SynWH7803_1435 (tpiA)
  Exosomal proteins of bladder cancer cells
   SynWH7803_1435 (tpiA)
  Exosomal proteins of melanoma cells
   SynWH7803_1435 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1318170..1318901
Genome map
AA seq 243 aa AA seqDB search
MRKPVIAGNWKMHMTCAQTRDWMGTFLPLISETPDDRHLVIAPPFTAISTLADVGAGSRV
EISSQNVHWEGHGAYTGEISPAMLQEHGVRYAIVGHSEPRKYFSESDEQINHRARSAQAH
DLIPIVCVGESDEQRSRGEAERVIRRQVEQGLEGLDPQRLVVAYEPIWAIGTGKTCESAE
ANRICGLIRSWVGSPDLIIQYGGSVKPANIDELMGMSDIDGVLVGGASLDPEGFARIANY
KKG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaaccggtgatcgcaggaaactggaagatgcacatgacctgtgcccagacccgg
gattggatgggcaccttcctaccccttatctccgagaccccggatgaccgccacttggta
atcgctccaccgtttacggcgatcagcacgcttgcggatgttggagctggcagtcgggtt
gaaatctccagccagaatgttcactgggaagggcatggggcttacacgggtgaaatctcg
ccggccatgcttcaagagcacggcgtgcgctacgccatcgttggccacagcgagccacgc
aaatacttcagcgaaagcgacgaacagatcaatcatcgggcccgttcagcacaggcgcac
gacttgattcccatcgtctgcgtcggcgaaagcgatgagcagcgcagccgcggtgaagcg
gaacgggtgatccgtcgacaggtggagcagggcctggaaggtctcgacccgcaacgcctg
gttgtggcctacgaaccgatctgggccatcggtacaggaaaaacctgtgaatcggcggag
gcgaatcggatctgtggattgatccgcagctgggttggttcacctgatctgatcattcaa
tacggaggatcggtgaagccagccaacatcgatgagctcatgggcatgagcgacattgat
ggtgtgctggttggaggcgcttcgctcgatccagaaggtttcgccaggatcgcgaattac
aaaaaaggctga

DBGET integrated database retrieval system