KEGG   Synechococcus sp. WH7803: SynWH7803_1436Help
Entry
SynWH7803_1436    CDS       T00524                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syx  Synechococcus sp. WH7803
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SynWH7803_1436 (folP)
Enzymes [BR:syx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SynWH7803_1436 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1318909..1319742
Genome map
AA seq 277 aa AA seqDB search
MRHPTCWGRRPAVMGVINLTPDSFSDGGQFNSAKQARKEADRQINDGADVLDLGAQSTRP
GAEEVGEEEELKRLIPCLQAIRRDHPDVIISVDTFLAAVATAALEAGADWINDVSGGRRD
AGMLPLIADAGCPYVLMHSRGDSASMDTCTNYGSEGVVNAVRRELRESTERALRQGVKAT
QLIWDPGLGFAKDNEQNLELIRQLEEFQRDGIPLLLGPSRKRFIGAVLNQPRPKARIWGT
AAVCARAQAAGVHVLRVHDVGPIHQVVSMGEAVARNT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatcccacctgctggggccgcagaccagctgtcatgggggtgatcaacctcaca
cccgattccttcagcgatggaggacagttcaacagtgccaagcaggccagaaaagaggct
gatcggcagatcaacgatggtgccgacgtgctcgatctcggtgcccagagcactcgacct
ggggccgaagaagtgggagaggaggaggagctcaaacgtctgatcccgtgcctccaagcc
atcagacgcgaccatcccgatgtgatcatttctgtggacacctttctcgctgctgtggcc
acagcagcgcttgaagcaggtgctgactggatcaacgacgtgagtggaggccggcgcgat
gcaggcatgcttcctttgatcgcggacgcgggctgtccttacgtgctgatgcacagcagg
ggagacagcgcttcgatggacacctgcaccaattacggcagcgagggtgtggtgaacgca
gtccgacgagaactgcgggagagcaccgagcgggccttgaggcaaggagtgaaagcaacg
caactcatctgggatccaggcttgggatttgccaaagacaatgaacaaaaccttgaactg
attcgccagctcgaagaattccaacgggatggcattcccctgctgctggggccctctcga
aaacgtttcatcggcgcggttctaaaccagccacgacccaaagcacgcatctggggtacc
gcagcggtctgtgcccgtgcccaggctgcaggcgttcatgtgttgcgggttcatgatgtc
ggtccaatccatcaggtggtgagcatgggcgaagccgtggctcggaacacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system