KEGG   Synechococcus sp. WH7803: SynWH7803_1438Help
Entry
SynWH7803_1438    CDS       T00524                                 

Gene name
chlH
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
syx  Synechococcus sp. WH7803
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1320217..1324230)
Genome map
AA seq 1337 aa AA seqDB search
MFTQVRSADRRVAPVEGQNHKSVMKAVYVVLEPQYQNALTQAATALNAAEGDLGIDLCGY
LIEELRDPDNYENFKRDVSEADVFIASLIFIEDLAQKVVEAVAPHRDRLKAAVVFPSMPE
VMRLNKLGSFSMAQLGQSKSAIAGFMKKRKEAGGAGFQDAMLKLLNTLPTVLKYLPVEKA
QDARSFMLSFQYWLGGTPENLRNFLLMLADKYVFPAAEGEERPVMEVAEPEVFPDLGIWH
PLAPTMFEDLKEYLNWTSSRPDLSDEARKGPVIGLVLQRSHIVTGDDAHYVAVIQELEFR
GARVIPIFCGGLDFSKPVNAFFYDPLNQEQPLVDGIVSLTGFALVGGPARQDHPKAIESL
KKLNRPYMVALPLVFQTTQEWEESDLGLHPVQVALQIAIPELDGAIEPIVLSGRDDATGK
AHTLQDRVDAIAERAIRWSSLRIKPRQQKKLAITVFSFPPDKGNVGTAAYLNVFGSIHRV
LEEMKAKGYDIQDLPRDSKTLMEAVINDPEAMQGAPELSIAHRMSVEEYERLTPYSERLE
ENWGKPPGNLNSDGQNLLIYGRHFGNVFVGVQPTFGYEGDPMRLLYSRSASPHHGFAAYY
TYLEKVWGADAVLHFGTHGSLEFMPGKQMGMSETCYPDSLIGSLPNLYYYAANNPSEATI
AKRRGYASTISYLTPPAENAGLYKGLKELGELVGSYQQLREGGRGVQIVNTIVETARQCN
LDKDVDLPEEDAASLELEGRDALVGAVYRQLMEIESRLLPCGLHTIGKPPTAEEAVATLV
NIAALEREEDGLRSLPGLLAEAMGRSIEDIYRGNDEGVLSDVELNRTITETSRAAIGSMV
RSLTGLDGRVNMRGNFGWLLDLLTKFGFKLPTPWLRACCAAGFTSIDSTELDKLFAYLRF
CLGQICADMEMESLLKALDGEYVLPGPGGDPIRNPGVLPSGKNIHALDPQAIPTRAAVAA
AKGVVDKLIERQREEQGTWPETIACVLWGTDNIKTYGESLAQILWFVGVKPMPDSVGRVN
KLELIPLEELGRPRIDVVVNCSGVFRDLFINQMALIDQAVKMAAEADEPLEQNFVRRHAL
EQAEKEGTSLRDAACRVFSNASGSYSSNVNLAVENSTWEEEGELQEMYLSRKTFAFNADN
PGEMNQKRDVFENVMKTADVTFQNLDSAEISLTDVSHYFDSDPTKLIKGLRDDGKAPTSY
IADTTTANAQVRSLSETIRLDSRTKLLNPKWYEGMLDSGYEGVREVAKRLNFTLGWSATS
GAVDNFVYEEANETFINDPEMRKRLLELNPHSFRRIVGTLLEVNGRGYWETSDENIQQLQ
ELYQEVEDRIEGVTPAA
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atgttcacacaggtccgctccgctgatcgtcgcgttgctcctgtggagggtcaaaaccac
aagtccgtcatgaaggcggtgtacgtggttcttgagccccagtaccagaacgcactgacc
caggccgccaccgcattgaatgctgcggagggagatctgggcatcgacctttgtggatat
ctgatcgaggaactccgcgatcccgacaactacgagaatttcaagcgtgatgtcagcgag
gccgatgtgttcatcgcctccctcattttcattgaggacctagcgcagaaagtggttgag
gctgtcgctccccatcgcgatcgactcaaggctgctgtggtcttcccctcgatgccagag
gtgatgcgcctcaacaagcttggctccttttcaatggcgcagcttgggcagagcaagagc
gccattgccggcttcatgaaaaagcggaaggaagccggtggtgctggttttcaggacgcc
atgctcaagctcctcaacacgcttccgacggtcctcaaatacctccccgtggagaaggcg
caggatgcacgcagcttcatgctcagttttcagtactggttgggaggtacgcccgaaaac
ctcaggaatttcctgctgatgctggccgacaagtacgtcttcccagcagctgagggcgag
gagcgtccggtcatggaggtggcggagcccgaggtgttccccgatctgggcatctggcat
cccctggcccccacgatgtttgaggacctcaaggaatacctcaactggacctcgagccgg
cctgatctgtctgatgaggcccgcaagggaccggtgatcggtttggtgttgcagcgcagt
cacatcgtgaccggcgatgacgcgcactacgtcgccgtcatccaggaacttgagtttcgg
ggcgcaagagtgattccgatcttctgcggtggtctcgatttctccaagccggtcaacgcc
tttttctatgaccccctcaaccaagagcagcctttggtcgacggcattgtgtcgctgact
ggcttcgccctggttggtggtccggcccgccaagatcacccgaaggcgattgagtcgctc
aaaaagctcaaccgtccctacatggtggcgttgccgttggtcttccagaccacgcaagag
tgggaggagagtgatcttggcctccaccccgtgcaggtggccttgcagatcgcgattcct
gagctggatggtgccatcgagcccattgttctttccggccgtgatgatgcaaccggcaag
gcccacaccctccaagatcgggttgacgccatcgctgaacgggcgatccgctggtcatct
ctgcgcatcaagccgcgtcagcagaagaaactggcgatcactgtgttcagctttcctcca
gacaagggaaatgttggaaccgccgcgtatctcaacgtgttcggatccattcatcgcgtt
ctcgaagagatgaaggcgaagggatatgacattcaggatctaccgcgtgattccaaaacc
ctgatggaagcggtgatcaatgaccctgaagccatgcagggggcaccggagctttcaatc
gcccaccgcatgagtgttgaggagtatgagcggctcactccttactccgagcgtttggaa
gagaactggggcaagcctcccggaaatctgaacagcgacgggcagaacctgctgatttac
ggccgtcacttcggcaacgtgtttgtgggggtgcagcccacattcggttacgaaggcgat
ccgatgcgcctgctttactcccgcagtgcgagtcctcaccatggcttcgctgcctactac
acctatctcgagaaggtttggggcgctgatgctgtgctccatttcgggacccatggttcg
ctcgagttcatgcccggtaagcagatgggcatgagtgaaacctgttatccggattcattg
atcgggtctctgccgaatctctattactacgcggcaaacaacccttctgaggccacgatc
gccaagcgtcggggctatgcctccacgatcagctacctcacgccgccagctgaaaacgct
ggtttatataaaggcctcaaggaacttggcgagctggttggctcttatcagcaactgcgt
gaaggcggtcgcggcgtgcagatcgtgaacacgattgttgaaacggcccgtcagtgcaac
ctcgataaagatgttgatcttcctgaggaggatgcggcatcccttgagcttgaaggtcgg
gatgctcttgttggtgctgtttatcgccagttgatggagattgagagccgcctgcttccc
tgcggtcttcacaccatcggcaagccccccaccgccgaagaagcggtggccacccttgtg
aatatcgctgcgctggagcgtgaggaagatggccttcgctcactgccaggactgttggcc
gaagcgatggggcgcagcatcgaggacatctatcggggaaatgatgaaggtgttctctcc
gatgtcgagctgaaccgaacgatcaccgaaacatcgcgtgctgcgattggctcgatggtt
cgctccctcacagggctcgatggtcgagtgaatatgcgcggtaatttcggatggcttctt
gatctgctgaccaagttcggcttcaagctgccgaccccctggttgagagcctgttgtgca
gccggcttcaccagcattgattccacagaactcgacaagcttttcgcctatttgcgcttc
tgtctgggacagatctgtgccgatatggagatggaaagtctgctgaaggctctcgacggt
gaatatgtgcttccggggcctggtggtgatccaatccgtaacccaggtgttcttcccagc
ggtaagaacatccatgcccttgatcctcaggccatcccaacccgtgcagctgttgcagca
gcaaaaggtgtggtcgataagctgattgagcgtcagcgcgaagaacagggcacgtggcca
gaaacgattgcctgtgttctttggggtacggataacatcaaaacctatggtgaatctctt
gcgcagattctctggttcgttggtgtcaagccaatgcctgattccgtgggcagggtcaac
aagcttgagttgattccccttgaagagttgggtcgccctcggattgatgtggtggtgaac
tgttccggtgttttccgtgatctgttcatcaatcagatggcgttgatcgaccaggctgtg
aagatggctgctgaggctgatgagcctcttgagcagaattttgtccgtcgccatgctttg
gagcaagctgagaaggaaggcacgtcactccgagatgctgcttgcagggtcttctcgaat
gccagcggaagttacagctcgaatgtcaaccttgctgttgaaaacagcacctgggaagaa
gaaggtgagttgcaggagatgtatctttccaggaaaacgtttgcattcaacgcagacaat
cctggcgagatgaatcagaagcgtgacgtctttgaaaatgtgatgaaaacagctgatgtc
acgttccagaacctcgactcagcagagatttcactgacggacgtgagccactatttcgat
agtgacccaacaaaactgatcaagggtctgcgtgacgacggcaaagctccgaccagctac
atcgctgacacgacaactgccaatgctcaggtgcgctctttgagtgagaccattcgcctg
gattcaaggaccaagctcctcaaccccaagtggtatgaaggcatgctcgattctggttat
gagggcgttcgtgaagtggccaagcgtcttaacttcaccctcggatggagtgccaccagt
ggagctgttgataacttcgtctatgaggaagcgaacgaaacgttcatcaacgatccggag
atgcgtaagcgtttgttggagttgaatcctcacagtttccggcgtatcgtcggtacactc
ctcgaggttaatggccgcggatactgggaaacgtctgacgaaaacatccaacaactccaa
gagctttatcaggaggttgaggatcggatcgaaggagttactcctgcagcgtga

DBGET integrated database retrieval system