KEGG   Synechococcus sp. WH7803: SynWH7803_1509Help
Entry
SynWH7803_1509    CDS       T00524                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
syx  Synechococcus sp. WH7803
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SynWH7803_1509 (recD)
Enzymes [BR:syx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SynWH7803_1509 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1385306..1386919
Genome map
AA seq 537 aa AA seqDB search
MIRSEGAQRSLQLGDGVMAMLRRRRPPAADLSATDQQALEELVQALTAALSAGDTSLRIE
ENQRELLERSGWLTDPPQVMVLDGDQLHWTRWHQAMQRLELELIDRSHAQPSGSLKTDSL
PTDSLPPDLGRLNTEQRAAVQAIRRHRLVMVSGGPGTGKTSTVQAMLLQAMAERGALRIH
LAAPTGKAARRLEEALQSDARTRSLPCTTLHRLLEARPSGFARNGRHPLNLDLLVVDEAS
MVDLNLAQALLSALPREAQLVLVGDADQLPPIGVGAVWRHLQHPERRHCFGDAAISLHRV
YRNRGELARLGSLLRDAGEEAFWNACNGLNDGANVTLQICRDRRIPDAVTQTLRHRLAEL
GRATADLSTDAEGQPNPTTSAELLGRLDDLIVLCPRRRGSWGVEALHRELVQGDDPAGWP
EGLPVLCSENQMDLGLANGDLGLAIGRGASRRLLFRCNDGHAGSLYRLIHPARIRQLEPA
LALTIHKAQGSEVDNVIVLWPPQEAQESSALLYTAMTRARQQLILYRLAPDVIDGML
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcagcgaaggggcacaacgcagcctgcaactcggcgacggcgtgatggccatg
ctgcgccgccgccgccctcctgcggcagacctgtcagcgacggatcagcaggcgctcgag
gaactcgttcaggcactcactgccgcactgagcgcgggagacaccagcttgcgcatcgag
gagaaccagcgcgagctgctcgagcgcagcggctggctcacggatcctcctcaggtgatg
gttctcgatggcgatcaactgcactggacgcgctggcatcaggccatgcagcgcctggag
ctggagctcattgatcgcagtcacgcacaacccagcggcagccttaaaacggacagcctt
cccacggacagccttccccctgacctcgggaggctcaatacggaacaacgggctgctgtt
caagcgatcagacgccatcgcctggtgatggtgagcggcggcccaggaacgggaaagacc
agcaccgtgcaagcgatgctgctgcaagccatggctgaacgcggagccctgcgcatccat
ctggcggctcctaccggcaaggcggcccggcgcctggaggaagcgctgcaaagcgacgct
cggacccggagcttgccctgcaccaccctgcatcgtcttctagaagcgcgccccagtggc
ttcgcgcgcaatggcaggcatcccctgaatctcgatctgctcgtggtcgatgaggcctcc
atggtggatctcaacctcgcgcaggctttgctcagcgccctgcctcgcgaagcacagctg
gtgctcgtgggagatgccgatcagcttccgcccatcggcgttggagcggtctggcgccat
cttcagcatccggagcgccggcactgtttcggtgatgccgccatcagcctccaccgggtc
tatcgcaacagaggtgagctggcacggctggggagcctgctccgcgacgctggcgaagag
gcgttctggaacgcctgcaacgggctgaacgacggggcgaatgtcaccctccaaatctgc
cgcgaccgtcgcatccccgacgcggtgacccaaaccttgcgccatcgcctcgccgagctc
ggccgcgcgacggccgacttgagcaccgacgccgagggccaacccaatcccacaaccagc
gcagaactgctggggcggctcgacgatctcatcgttctttgtcctcgtcgccggggatcc
tggggtgttgaggccctgcatcgcgaactggtgcagggcgatgatccggcgggatggcct
gaagggttgccggtgctgtgcagcgaaaatcagatggatctcggactcgccaatggcgac
ctgggcctggcgatcggtcgcggtgcgtcgcgacggttgctgttccgttgcaacgacggc
catgcaggcagcctgtaccgactgattcatccggcgcgcatccgccagctggaaccggct
ctagccctcaccattcataaggcgcagggaagtgaggtcgacaacgtgatcgtgctctgg
cctccacaggaggcacaggagtcttcagcccttctctacacagcgatgacccgggcacgc
caacagctcatcctgtatcgcctggcgccagacgtgatcgacggcatgctgtga

DBGET integrated database retrieval system