KEGG   Synechococcus sp. WH7803: SynWH7803_1525Help
Entry
SynWH7803_1525    CDS       T00524                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
syx  Synechococcus sp. WH7803
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SynWH7803_1525 (recR)
DNA repair and recombination proteins [BR:syx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SynWH7803_1525 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1401690..1402289
Genome map
AA seq 199 aa AA seqDB search
MSGFTRPLARLIDQFERLPGIGPRTAQRLALHLLRQPEEQIRSFADALLAARTEVGHCQT
CHHLSAEPTCEICRNPERANGQICVVADSRDLLALERTREFSGHYHVLGGLISPMDGIGP
DLLQISSLVKRVAANNTEEVILALTPSVEGDTTSLYVARLLKPFTRVSRIAYGLPVGSEL
EYADDVTLSRALEGRRAVE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ctgagcggcttcacccgcccactggcacggctgatcgatcaattcgagcggttgcctgga
atcggaccacgcactgcgcagcgactggccctgcatctgcttcgccaaccggaggagcag
atccgcagctttgccgatgcacttctggcggcacgaacggaggttggccactgccagacc
tgccaccatctcagcgcggagcccacctgtgagatctgccgcaaccccgaacgggccaac
ggacagatctgcgtggtcgccgactcacgcgatctcctggcgctggagcgcacccgggaa
ttttctggccactatcacgttctcggaggcctgatctcaccgatggatggaatcggcccc
gaccttcttcagatctccagtttggtgaagagggtcgcagccaacaacaccgaagaagtg
atcctggcgctgacgcccagcgtggaaggcgataccaccagcctttatgtggccaggttg
ctcaaaccgttcacccgcgtcagtcggattgcctatgggcttccggtggggagcgagctg
gaatacgccgacgacgtcaccctgagccgggcgttggaagggcggcgggctgtggagtga

DBGET integrated database retrieval system