KEGG   Synechococcus sp. WH7803: SynWH7803_1549Help
Entry
SynWH7803_1549    CDS       T00524                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syx  Synechococcus sp. WH7803
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SynWH7803_1549 (malQ)
Enzymes [BR:syx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SynWH7803_1549 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1426001..1427491)
Genome map
AA seq 496 aa AA seqDB search
MLLHPTALPGSPVCGTFGAAARDWLHALARQGIRVWQVLPLAPPDGTGSPYSSPSSFAIN
PWLLDAQDLSDEGFITPDDVQALPQAAPADAEGGEQLDFALAAQRADALARSLRLRWAGQ
PADRHEAFQRWCIDQSRWLRDHAAFMVLRREHAGLPWWDWAHELAVHRETALEHWRCTHR
SDLLEQDLLQWHLDRQWRRLRALASDLGVEILGDLPFYVARDSADVWSNRSLFSIAGDGR
LHQQSGVPPDYFSATGQLWGTPVYTWGRHRRTGFRWWRDRLRRQWDLADRLRLDHFRALA
AYWSVPGSDDTAMNGRWQRSPGGELLACLKRDAGGSLPIVAEDLGVITPDVERLRDRFHL
PGMKVLQFAFDGNADNPYLPANIKGSGWVVYTGTHDNPTSLGWWERLEQSSRDQVAATLE
RSVEAPGWQLLELGLSTSAALVVAPLQDLLHLDDAARFNTPGTVGGNWMWRLPALDGALN
GALEGYGVRAEVWSRR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgctcctgcaccccacagcgcttccaggatcgccggtgtgcggcacgttcggtgctgcg
gctcgagactggctgcatgcgctcgctcgccagggcatcagggtgtggcaagtgctgcct
cttgctccaccggatggaacgggatctccctacagctcgccgtcgagtttcgccattaat
ccctggttgctcgatgcccaggatctgagcgatgaggggttcatcacccccgatgatgtg
caggctcttcctcaggcagctccggcggacgcagaaggaggcgaacagcttgatttcgct
ttggccgctcaacgggccgatgcattggccagatcgttgcgtctgcgatgggcggggcag
cctgctgatcgccacgaggccttccagcgatggtgcatcgaccagtcacgttggttgcgt
gatcacgccgccttcatggtgctgcgtcgtgagcatgcgggtttgccctggtgggattgg
gcacatgagctggcggtccaccgcgagacggcactggagcactggcgttgcacgcaccgg
agtgatctgctggagcaggatcttcttcaatggcatctggatcgtcagtggcgccggctc
cgcgctctggcaagcgacctaggggtggagatccttggtgatcttcctttctatgtcgcc
cgcgacagcgctgatgtttggagcaaccgctcgctgttttcgattgccggagatggacgc
ctccatcagcagagtggtgttccaccggattacttttccgccaccggccagctctgggga
acacccgtctacacctgggggcgccatcggcgcacaggattccgctggtggcgtgatcgc
ctgcggcgtcaatgggatcttgctgacaggcttcgccttgatcatttccgtgctttggcc
gcctattggtcggttcccggctctgatgacacggccatgaacggccgctggcaacgctct
cccggcggcgaacttctggcttgtctgaagcgtgatgccggtgggtctctgccgattgtg
gctgaggatctcggggtcatcacccctgatgtggagcgactgcgcgatcgcttccatctc
cctggcatgaaggtgctgcagttcgcttttgatgggaatgcagacaatccctatctgcca
gccaacatcaaaggcagtggttgggttgtgtacacaggaacccatgacaatccaacgagc
ctcggttggtgggagaggttggaacagtcgtcaagagatcaggtcgcagcaacgcttgag
cgcagcgttgaggctcctggatggcagctccttgagctgggtctatcaacatcggctgct
ttggtcgtggcccctctgcaggatctgttgcatctggatgatgcggcccgtttcaacaca
cccggcaccgtgggtggaaactggatgtggagattgccggctctggatggcgccctcaat
ggggcactggaaggttatggagtgcgtgctgaggtctggtcgaggcggtaa

DBGET integrated database retrieval system