KEGG   Synechococcus sp. WH7803: SynWH7803_1550Help
Entry
SynWH7803_1550    CDS       T00524                                 

Gene name
frhB
Definition
(GenBank) Coenzyme F420-reducing hydrogenase, beta subunit
  KO
K21231  
3,8-divinyl protochlorophyllide a 8-vinyl-reductase (ferredoxin) [EC:1.3.7.13]
Organism
syx  Synechococcus sp. WH7803
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SynWH7803_1550 (frhB)
Enzymes [BR:syx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.13  3,8-divinyl protochlorophyllide a 8-vinyl-reductase (ferredoxin)
     SynWH7803_1550 (frhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1427546..1428754)
Genome map
AA seq 402 aa AA seqDB search
MTSSPASPLPHDQARPIPRDRIRPAKDLCSDCGLCDSRWVAYVRQACAFLHQDFDGMERK
AHGRARDLDQEDELYFGVQQRMLTARLQTPIAGAQWTGIVSRLGVRALETGLVDAVLCVQ
QSPDDRFTPMPVLARTPEEVLAARVNKPTLSNNLSVLEQLPGSGIKRLLAIGVGCQVQAL
RAVQDTLPLEALYVLGLPCVDNVSREGLQTFLESASATPDTVVHYEFMQDFRIHFRHSDG
RVETVPFFGLDTPALKDVFAPSCLSCFDYVNAGADLVVGYMGAEFGRQWLVVRNSRGEDL
LKLVEAELDQAPVMSRGDRRQAVQQGIDAYDKALRLPMWLAEVVGWIVQRVGPKGLEYGR
FSIDSHFTRNALWLRRHHPEVVERHLPAFARRIVERYRLPAR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttcccccgcttcaccgcttccccacgaccaggcgcgaccgattccccgcgac
cggatccgtccggccaaggatctctgcagtgactgcggcctctgtgattcgcgctgggtt
gcctacgtgcgccaggcctgtgccttccttcatcaggacttcgatgggatggaacgcaag
gcccatggccgcgcccgcgatctcgatcaagaggatgagctgtatttcggggttcagcag
cggatgctcaccgcgcggctgcagacgccgatcgctggagcccagtggacgggaattgtc
agtcgcctgggggttcgcgccctggagacggggctcgttgatgccgtgctctgcgttcag
caaagcccagacgatcgcttcacgccgatgcccgttctggcacgcacgccggaggaggtg
ctggctgcaagggtcaacaaacccaccctgtccaacaacctttccgttctcgagcaactg
ccgggcagcgggatcaaacgcttgctggcgatcggtgtgggctgccaggttcaggcgctg
cgtgccgtgcaggacaccctcccgctcgaagcgctttacgtgctggggctcccctgtgtg
gacaatgtctcccgggagggtcttcagacttttctggagagcgccagtgccacaccggac
acggtggtgcactacgagttcatgcaggatttcaggattcatttcagacacagcgatggt
cgtgttgaaacggtccccttcttcggtcttgacacgccggctctcaaggatgtcttcgct
ccgagctgtctgagttgtttcgactacgtcaatgccggcgctgatctggtcgttggctac
atgggtgctgaattcggacgtcagtggttggttgtgcgtaattcacgcggggaggacttg
ctgaagctggtggaagcggagctcgatcaggcaccggtgatgagccgaggcgatcgtcgc
caggctgttcagcagggcatcgatgcctacgacaaagccctgcgactgcccatgtggctc
gcggaggtcgtgggctggatcgtgcagcgggttgggccgaaaggattggaatacggccgc
ttctcgatcgattcccacttcacccgcaatgcgctctggctccgccggcatcatcctgag
gtggtggagcgtcatctgcccgctttcgcgcggcgcatcgttgagcgctaccgcctgccc
gcccgctaa

DBGET integrated database retrieval system