KEGG   Synechococcus sp. WH7803: SynWH7803_1550Help
Entry
SynWH7803_1550    CDS       T00524                                 

Gene name
frhB
Definition
coenzyme F420-reducing hydrogenase subunit beta (EC:1.12.98.1)
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
syx  Synechococcus sp. WH7803
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:syx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1427546..1428754)
Genome map
AA seq 402 aa AA seqDB search
MTSSPASPLPHDQARPIPRDRIRPAKDLCSDCGLCDSRWVAYVRQACAFLHQDFDGMERK
AHGRARDLDQEDELYFGVQQRMLTARLQTPIAGAQWTGIVSRLGVRALETGLVDAVLCVQ
QSPDDRFTPMPVLARTPEEVLAARVNKPTLSNNLSVLEQLPGSGIKRLLAIGVGCQVQAL
RAVQDTLPLEALYVLGLPCVDNVSREGLQTFLESASATPDTVVHYEFMQDFRIHFRHSDG
RVETVPFFGLDTPALKDVFAPSCLSCFDYVNAGADLVVGYMGAEFGRQWLVVRNSRGEDL
LKLVEAELDQAPVMSRGDRRQAVQQGIDAYDKALRLPMWLAEVVGWIVQRVGPKGLEYGR
FSIDSHFTRNALWLRRHHPEVVERHLPAFARRIVERYRLPAR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttcccccgcttcaccgcttccccacgaccaggcgcgaccgattccccgcgac
cggatccgtccggccaaggatctctgcagtgactgcggcctctgtgattcgcgctgggtt
gcctacgtgcgccaggcctgtgccttccttcatcaggacttcgatgggatggaacgcaag
gcccatggccgcgcccgcgatctcgatcaagaggatgagctgtatttcggggttcagcag
cggatgctcaccgcgcggctgcagacgccgatcgctggagcccagtggacgggaattgtc
agtcgcctgggggttcgcgccctggagacggggctcgttgatgccgtgctctgcgttcag
caaagcccagacgatcgcttcacgccgatgcccgttctggcacgcacgccggaggaggtg
ctggctgcaagggtcaacaaacccaccctgtccaacaacctttccgttctcgagcaactg
ccgggcagcgggatcaaacgcttgctggcgatcggtgtgggctgccaggttcaggcgctg
cgtgccgtgcaggacaccctcccgctcgaagcgctttacgtgctggggctcccctgtgtg
gacaatgtctcccgggagggtcttcagacttttctggagagcgccagtgccacaccggac
acggtggtgcactacgagttcatgcaggatttcaggattcatttcagacacagcgatggt
cgtgttgaaacggtccccttcttcggtcttgacacgccggctctcaaggatgtcttcgct
ccgagctgtctgagttgtttcgactacgtcaatgccggcgctgatctggtcgttggctac
atgggtgctgaattcggacgtcagtggttggttgtgcgtaattcacgcggggaggacttg
ctgaagctggtggaagcggagctcgatcaggcaccggtgatgagccgaggcgatcgtcgc
caggctgttcagcagggcatcgatgcctacgacaaagccctgcgactgcccatgtggctc
gcggaggtcgtgggctggatcgtgcagcgggttgggccgaaaggattggaatacggccgc
ttctcgatcgattcccacttcacccgcaatgcgctctggctccgccggcatcatcctgag
gtggtggagcgtcatctgcccgctttcgcgcggcgcatcgttgagcgctaccgcctgccc
gcccgctaa

DBGET integrated database retrieval system