KEGG   Synechococcus sp. WH7803: SynWH7803_1687Help
Entry
SynWH7803_1687    CDS       T00524                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
syx  Synechococcus sp. WH7803
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1542513..1543256)
Genome map
AA seq 247 aa AA seqDB search
MGASPDPIVLPGGSTTVVLIHGYTGSPAEMGLLADSLQREGYGVECPLLAGHGTCLEDLM
PVDPVQWLNQLDAVVDRLQQQGQSVVVGGLSLGAILALQVARRRPSIQGVITCSPPIISA
DPRALIAPLLAKVLASVPRPPDDFVDPTTAERIWTYNRWPSRCSVKVLELIADTRRHLAE
VRQPLLVMASRLDRVITVRGVNRLCERVSSRSVQLQWLENSGHLITTDAEWRTVAAVTAE
FIKCLGV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcctcacccgatccgatcgttttgcccggtggttccaccaccgtggtgttgatt
catggctacaccggatcacctgctgagatgggtctgctggccgactctttgcagcgcgag
ggctatggggtggagtgccccttgctcgctgggcatggcacctgcctcgaggatctgatg
ccggtggatcccgtgcaatggctcaatcagctcgacgccgtggtcgatcgcttgcagcag
caaggtcagagcgtggtggtgggtggtttgtcgttgggggcgatcctggcgttgcaagtg
gcgcggcggcgaccgtccatccaaggggtgatcacctgttcacctccgatcatcagcgct
gatccccgtgctctgatcgcaccgttgctggccaaggttctggcttcggttccgcggccc
cctgatgacttcgttgatcccaccaccgctgagcgcatctggacctacaaccgctggcca
tctcgctgcagcgtgaaggttctggagctgattgccgacacgcgccgccatctggcggaa
gtgaggcaacccttgctggtgatggccagccgcttggaccgggtgatcacggtgcgcggt
gtgaatcgtttgtgtgagcgggtcagctctcgttctgtgcagctgcagtggttggagaac
agcggtcacctgatcaccacagacgctgaatggcgcaccgtggccgctgtgactgctgag
ttcatcaagtgtcttggggtttga

DBGET integrated database retrieval system