KEGG   Synechococcus sp. WH7803: SynWH7803_1695Help
Entry
SynWH7803_1695    CDS       T00524                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
syx  Synechococcus sp. WH7803
Pathway
Other glycan degradation
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:syx00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1549914..1552415)
Genome map
AA seq 833 aa AA seqDB search
MAPLGLSALRSLLRRSSRPQAWTPPEASWSRPFGLGWDQPYTVRYASNLDDGPWHGMPLG
GFGAGCIGRSSRGDFNLWHLDGGEHWYGTIPDCQFALFESNGSSQRAHALAVKPEADASR
PNSAEPLAAWDWYPASTPERSTGTYAARYPLSWTHYEGVYDAEVSCEAFSPILPGDYQRT
SYPVAVFRWTLRNPSDQPLDLSLLLSWRNTVGWFFNTDPSAEVHFRDDGSPEHNYAPAIG
QGEGQRNRWLDQEGVRGIVLEGQRSEPIGEGQGQWCLAVPDALEGVEVLRCSRWDPTGDG
QELWQSFAAEGRIPNSNNDRSSRAGEQASAAIALKFTLAPGESREIPIAISWDLPVTAFA
TGVRDLRRYTDFFGADGCNAAALAAEALRDWRQWRDQIDAWQAPVLARQELPEALRMALF
NELYDLASGGSLWTAASGKDPHGRFGVLECLDYAWYESLDVRLYGSFALLQLWPELDKAV
LRSFARAIPAADATQRPIGWYFTQGRGRVEADRKVKGATPHDLGAPNEVPFDATNYTAYQ
DCNLWKDLASDFVLQVWRTFKLAPTGEDLKFLADCWPAAVQALHYLKRFDVNNDGLPDNG
GAPDQTFDDWPLKGVSAYCGALWIAALEAALAMAQRLQQELGLDTGSDQHTFSAWLEQSR
SNFDRLLWNGEYYDIDAESGTPVVMADQLCGDFYARLLGLEPVVSEANSRSTLKAVKESC
FEKFQGGSLGVANGLRRDGTPLDPNGTHPLEVWTGINFGIASYYRLMGEGQTAEAICSAV
VDQVYSGGLQFRTPEAITAVNTFRACHYLRAMAIWGLWATHTDWQRIPGAERG
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggctcccctcggtctgtctgccctgcgctcgctcctgcgccgcagttcccggccgcag
gcctggacgccacctgaggccagttggagccggccgttcggtttgggctgggatcagccc
tacacggtgcgttacgccagcaatcttgatgacggcccctggcacggcatgcccctgggg
ggctttggtgctggttgcatcggccgcagctcccgcggtgacttcaacctctggcacctc
gatggtggagagcactggtatggaacgatccccgactgccagttcgccctgttcgaaagc
aacggcagcagccaacgggcccacgcgttggccgtgaagcccgaggcggatgcctcacgc
cccaacagcgctgagcccctggccgcctgggattggtatcccgccagtacgccggagcgc
agcaccggcacctacgccgcccgctatcccctgagctggacccattacgagggcgtctac
gacgccgaggtgagttgcgaggcgttcagcccgattcttccaggcgactaccaacgcacc
agttacccggtggccgtgttccgctggaccctgcgcaaccccagcgatcaaccgttggat
ctgtcgttgctgctcagttggcgcaacaccgtgggttggttcttcaacaccgacccctcg
gcagaggtgcacttccgcgacgacggcagcccggagcacaactacgcgccggcgatcggc
cagggcgaaggacaacgcaaccgttggttggatcaagagggtgtacgcggcatcgtgctg
gagggccagcgcagtgagccgatcggcgagggccagggtcagtggtgtctggcggtgccg
gatgctctggagggcgttgaggtgctgcgctgcagccgctgggaccccacgggcgatggc
caggagctctggcaatcgttcgctgcggagggccgcattcccaacagcaacaacgatcgc
tccagccgtgcgggcgagcaggccagtgcagcgatcgccttgaagttcaccctggccccc
ggggaatcccgagagatcccgattgcgatcagctgggatctgccggtcaccgccttcgcg
accggtgtgcgtgatctgcgccgctacaccgatttcttcggagccgatggttgcaatgct
gcggcgttggcagcggaagcgctgcgcgactggcgccagtggcgtgatcagatcgatgcc
tggcaggccccggtgctggcgcgtcaggagctgccggaagccttgcgtatggctctgttt
aatgagctctacgacctggccagtggcggaagcctctggactgcggcatcgggcaaggat
ccccacggccgcttcggcgtgctcgagtgcctcgactacgcctggtatgaaagtttggat
gtgcggctctatggctcctttgccctgctgcagctctggccggagctcgacaaggccgtg
ctgcgcagtttcgccagagcgatcccggcggcggatgccacccagcggccgatcggttgg
tatttcacccaggggcgtggccgcgtggaagccgatcgcaaggtgaagggggccacgccg
cacgacctgggggctcccaatgaagtgccctttgatgccaccaattacacggcgtaccag
gattgcaatctctggaaagacctcgccagtgactttgtgctgcaggtgtggcgcaccttc
aagctggcacccaccggcgaagacctcaaattcctggccgattgctggcctgcggcggtg
caggccttgcactatctgaagcgttttgatgtcaacaacgacggcttgcccgacaacgga
ggtgctcctgatcagaccttcgacgactggccgctgaagggggtgagtgcctactgcggc
gcgttgtggatcgctgcgctggaagccgctctggccatggcccaaaggctgcagcaggag
ctggggctggacacgggcagcgatcagcacaccttcagcgcctggcttgagcagtcgcgc
agcaacttcgatcgtttgctctggaatggcgagtactacgacatcgacgccgaaagcggt
acgcccgtggtgatggccgatcagctctgtggtgatttctatgcgcgcctgctggggctg
gagccggtggtgagtgaggccaacagccgcagcacgctcaaggccgtgaaagagagctgc
tttgagaagttccagggcggcagcctcggggtggccaatggcctgcgccgcgatggcaca
cccctggatcccaatggcacccaccccttggaggtgtggacgggcatcaacttcggtatt
gccagctactaccgactgatgggcgaaggccaaaccgccgaagcgatctgctcagcggtg
gtggatcaggtgtacagcggtggtctgcagttccgcacgccggaggcgatcacggcggtg
aacaccttccgcgcttgccactacctgcgggcgatggcgatctggggactgtgggcgacg
cacaccgactggcaacggattccgggggcggagcggggttag

DBGET integrated database retrieval system