KEGG   Synechococcus sp. WH7803: SynWH7803_1743Help
Entry
SynWH7803_1743    CDS       T00524                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syx  Synechococcus sp. WH7803
Pathway
syx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syx01100  Metabolic pathways
syx01110  Biosynthesis of secondary metabolites
syx01130  Biosynthesis of antibiotics
syx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SynWH7803_1743 (trpC)
Enzymes [BR:syx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SynWH7803_1743 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CAK24169
CyanoBase: SynWH7803_1743
CYORF: SynWH7803_1743
UniProt: A5GMK4
Position
complement(1594750..1595634)
Genome map
AA seq 294 aa AA seqDB search
MEIRRRPPNPKVQVAHLEYAIPHQDGEPRNILEKIVWEKDREIETARQRMPLVQLKARVA
ELPPALDFLGALRQAPVAPAVIAEVKKASPSKGVIREDFDPVAIAKAYAAGGASCLSVLT
DRTFFQGGFDVLVAVREAVDLPLLCKDFILSPHQLYQARAAGADAALLIAAILTDQDLAY
LQKVAATLGLTVLVEVHDAAEMERILTLGGFPLIGINNRDLTSFETDLATTEALTQQFAD
RLRAQDAFLVSESGLFARADLNRVQRSGAGAVLVGEALMRQDNVEQGLRDLIAP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgtcgtcgaccgcccaaccccaaggttcaggtggcccatctcgaatacgcc
atcccccaccaggatggtgaaccgcgcaacattctcgagaagattgtctgggaaaaggat
cgcgagatcgaaaccgcccgccagcgcatgccactggtgcagttgaaggcacgggttgct
gaactgccaccggcgctggactttctgggagcgttgcgtcaggcccctgtggctcctgca
gtgattgctgaagttaagaaggccagtcccagcaaaggggtgattcgtgaggatttcgat
cccgttgccatcgccaaggcctatgccgctggtggggccagttgtctgtccgtgctcacg
gatcgcaccttttttcagggtggcttcgatgtgctggttgctgtgcgcgaagccgtggac
ctgccgttgctctgcaaggacttcatcctcagtccccatcagctttaccaggcgcgtgcg
gctggtgccgatgcggctctgctgattgctgccatcctcacggaccaggatctcgcctat
ctccagaaggtggccgccaccctgggtctcaccgtgctggtggaagtgcacgatgccgcg
gagatggagcgcattctcacccttggaggctttcctctcatcggcatcaataaccgcgac
ctcaccagctttgagacggatctggcaaccacagaagcgctcacgcaacagtttgcggat
cgcctgcgcgcgcaggacgccttcctcgtcagtgaatcgggtttgtttgcgcgtgccgac
ttgaatcgtgtgcaacgcagtggtgccggtgcggtgctcgtgggcgaagccttgatgcgt
caagacaatgtggagcaggggctgcgcgatttgatcgcgccataa

DBGET integrated database retrieval system