KEGG   Synechococcus sp. WH7803: SynWH7803_1746Help
Entry
SynWH7803_1746    CDS       T00524                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
syx  Synechococcus sp. WH7803
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SynWH7803_1746 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SynWH7803_1746 (murA)
Enzymes [BR:syx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SynWH7803_1746 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1598495..1599793
Genome map
AA seq 432 aa AA seqDB search
MTTAAPPSQDILKPHLAIDGGHSLQGELKVSGAKNSALVLMTASLLTAERLTLHNVPPLT
DIDGMENILVSLGVKVHRRSETVELEASHLTSAEPPYDLVNGLRASFFAIGSILARMGYA
KVPLPGGCRIGARPVVEHIRGLKALGASVSVEHGVVTAAVPGEGKRLKGASIVLDCPSVG
ATETILMAATLAEGTSVIENAAQEPEVQDLANLLNAMGARITGAGGPTITIHGVEALHGC
EYSVILDRIEAGTFLLAAAITRSRLRVAPVVPEHLNAVLQKLRDCGCELEIDGDGITITP
GTIKGVDITTQPFPGFPTDLQAPFMALLATASGTSVITEKIYENRMQHVAELQRMGAAIR
IQGSTAIVEGVPSLSAAPVNGTDLRAAAAMVLAGLVARGSSQVSGLNHLDRGYAGIEAKL
RACGAVLERHLP
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcggcgcctccgtctcaggacattctcaagccgcacctcgcaatcgatggt
ggacacagtcttcagggagaactgaaggtcagtggagccaagaactcagccctggtgttg
atgacggcctccctgctcacggctgaacgtctcactcttcacaacgttccacccctcacc
gacatcgacgggatggaaaacatcctggtgtcccttggagtgaaggttcatcgccgctca
gaaactgtcgaactcgaggcgtcccatctcacaagcgccgaacccccctacgacctagtg
aatgggctgagggccagcttttttgcgattggttccatcctcgcccggatggggtacgcc
aaggtgcccctccctggcggctgccgcatcggcgcacggcctgtagtggagcacatccgc
ggtttgaaagccttgggcgcatcggtctccgtggagcacggtgtcgtcacagcggccgtt
cccggcgagggcaagcggctcaaaggggcgtccatcgtgttggactgcccgagcgtgggc
gccacggaaacaatcctgatggccgcgactctggctgaaggcaccagcgtgattgaaaac
gctgctcaggagcctgaggttcaggatcttgccaacctcctcaatgccatgggggcgcgc
atcaccggcgcgggtggtcccacaatcacgattcacggggtggaggccttgcacgggtgt
gagtactccgtgattcttgatcgcatcgaggctggaacctttctgctcgcagcggccatc
acccgttcccggctgcgggttgcaccggttgtgcccgagcatctgaatgctgtgctgcag
aaactgcgggactgtggctgtgagcttgagatcgacggggacggcatcacgatcacccct
ggaacgatcaagggcgtggacatcaccacccagcccttccccggttttcccacggatcta
caggctcccttcatggcgctgctggccacggcttctggcacgagcgtgatcaccgagaag
atctacgaaaacaggatgcaacacgtggccgagctgcagaggatgggcgcagccatccgc
atccaggggagcaccgccattgttgagggtgtcccgagcctcagtgctgccccagtgaac
ggcacggatctcagggcagcggctgccatggttcttgcaggcctcgtggctcgaggcagc
agccaggtgagtggccttaaccatctcgatcggggttatgccggaatcgaagccaaactg
cgtgcctgcggtgcggtgctcgaacggcacctgccctga

DBGET integrated database retrieval system