KEGG   Synechococcus sp. WH7803: SynWH7803_2299Help
Entry
SynWH7803_2299    CDS       T00524                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syx  Synechococcus sp. WH7803
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SynWH7803_2299 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynWH7803_2299 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SynWH7803_2299 (trpB)
Enzymes [BR:syx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SynWH7803_2299 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2120886..2122136)
Genome map
AA seq 416 aa AA seqDB search
MTSTLPSQPSASDLAVSSRPAAAGRFGRYGGQYVPETLMPALAELEQAAAQAWKDPAFTA
ELNRLLKSYVGRATPLYEAERLTEHYRRADGGPRIWLKREDLNHTGAHKINNALGQALLA
LRMGKKRVIAETGAGQHGVATATVCARFGLECVVYMGAEDMRRQALNVFRMRLLGATVHP
VTAGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGQETRQQCRE
AFGRLPDVLMACVGGGSNAMGLFHPFVECTDVRLIGVEAAGDGVATGRHAATITEGRVGV
LHGAMSLLLQDQDGQVQEAHSISAGLDYPGVGPEHSYLREIGRAEYGAVTDAEALEALQL
VSRLEGIIPALETAHAFAWLETLCPTLSAGTEVVLNCSGRGDKDVNTVAERLGDAL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccttgccctcgcaaccctctgcctccgatctcgccgtcagttcgcgtcca
gcggctgctggccgttttggtcgttacggcggtcagtacgtcccagaaacactgatgccg
gcattggccgagctggagcaagcggctgctcaggcctggaaagatcctgcgttcaccgcg
gaactcaatcggctgctgaagagctacgtcggccgggctacaccgctttacgaagcggaa
cggctcacggagcactaccgccgtgccgacggtggtccccgcatctggctgaagcgggaa
gacttgaatcacaccggtgcccacaagatcaataacgctcttgggcaggcccttctggct
ctgcggatgggtaagaagcgggtgatcgccgaaaccggtgctggccagcatggtgtggcc
accgccaccgtttgtgcccgcttcggcctggagtgtgtggtgtacatgggcgctgaagac
atgcgccgacaggctttgaacgtgttccggatgcgcctcctcggtgccaccgttcacccg
gtgacggcggggaccgccaccctcaaagacgccaccagtgaggcgatccgtgactgggtc
accaatgtggagaccacgcactacatccttggatctgtggcgggtccccatccttatccc
atgctggtgcgtgactttcacgcggtgatcggtcaggaaacccggcagcagtgccgggag
gcgtttgggcgtctgcccgacgtgttgatggcctgcgtcggtgggggatcgaatgcgatg
ggcctgttccacccctttgttgagtgcaccgatgtgcgtctgattggtgtggaagccgct
ggtgacggcgtcgcaaccggacgccatgccgccaccatcaccgaaggacgggtgggcgtg
ctgcacggagcgatgagtctcctcctgcaagaccaggacggtcaggtgcaggaagcgcat
tccatcagtgccggtctggactatccaggtgtcggccctgagcacagctacctgcgtgag
atcgggcgagctgaatatggtgctgtcaccgatgccgaggcgctggaagccctgcagctg
gtgagtcggctggaagggattattcctgctctggaaacggcccatgccttcgcctggctg
gaaacgctttgccccacactctccgcaggaacggaagtggttctcaattgttcaggtcga
ggcgacaaggatgtcaacaccgtggcagaacgtctcggagatgccctctga

DBGET integrated database retrieval system