KEGG   Synechococcus sp. WH7803: SynWH7803_2454Help
Entry
SynWH7803_2454    CDS       T00524                                 

Gene name
speB
Definition
putative agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syx  Synechococcus sp. WH7803
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SynWH7803_2454 (speB)
Enzymes [BR:syx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SynWH7803_2454 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2284410..2285294
Genome map
AA seq 294 aa AA seqDB search
MTTNGLDSVGAEEMFDQDGAIFMGARRDPSDCQVGVFGVPYDGTTSFRPGTRFGPAAIRE
VSSGLETYCPQLDRDLDTLAYADLGALNIAYGAPEPVVQAVEQATARILALGLKPLMLGG
EHSITSGAVAAVAREHPDLVLVQLDAHADLRQTWLGASHSHACAMRRCLEVLPSEDLLQI
AIRSGTADEFSELHRSSRLVPLHQLHQRLSALRGRPIYLTVDLDWFDPAVMPGTGTPEPG
GFTWPDFAALVDALQHHNLMAADVVELAPQLDPSGISSVLAAKVTRSLLLLMTQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaacggattggacagcgttggggctgaggagatgtttgaccaagacggagcg
atcttcatgggcgctcgccgcgatccatccgactgtcaggtcggtgtgttcggcgtgccc
tacgacggcaccacatcattccgccctggaacccggttcggccctgccgcgatccgagag
gtcagttccggcctggagacgtactgcccgcagctcgatcgagacctcgacaccctggcc
tacgccgatctcggcgcgctcaacatcgcctatggagcacccgagcccgtcgtgcaggcc
gttgaacaggcaacggccaggattcttgccctgggccttaaaccgctgatgctcggtggg
gaacactccatcacctccggcgccgtcgcggctgtggccagggagcatcctgatttggtg
ctggtgcaactggatgcccatgccgatctcaggcagacctggctgggcgcaagccacagc
catgcctgcgccatgcgccgctgcctggaggtgctgcccagtgaagacctgctgcaaatc
gccatccgcagcggaacggcggatgaattttcagaactgcatcgcagcagccgcttggtt
cctctgcatcagctgcatcagaggctcagcgctctgcgcggacggccgatctatctcact
gtggatctcgactggttcgaccctgccgtgatgccaggcacggggacacctgaacccggg
gggttcacctggcctgacttcgctgcgctggtcgatgcgctgcaacaccacaatcttatg
gccgcagacgttgttgaactcgcgcctcagctcgatcccagcgggatcagcagtgtgctg
gcagccaaggtcacccggagtttgctgctcttaatgactcaataa

DBGET integrated database retrieval system