KEGG   Synechococcus sp. WH7803: SynWH7803_2474Help
Entry
SynWH7803_2474    CDS       T00524                                 

Definition
alpha-glucosidase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
syx  Synechococcus sp. WH7803
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SynWH7803_2474
Enzymes [BR:syx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SynWH7803_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2304788..2306518)
Genome map
AA seq 576 aa AA seqDB search
MQFQSERTLGNLLRCLYECHPSGDLESLSSQLLQILGSASANGEIRTQGNPWCVDDVVLI
TYADTVVEDDQPALVSLRTFLNCHLSEFAAVLHVLPFLEASSDGGFAVASHERLEERHGD
WSDLAELAQGRRLMADLVLNHVSASHPWVRQFLRDQEPGRFCVLEAGPDPCWDNVVRPRS
SALFTKLQGPISMREVWTTFGPDQVDVDWRHPEVLLGFTRLLARMVTHGVGWIRLDAVGF
VWKEPNTTCIHLPQAHQLVELLRQLLTIACANGVVVTETNVPEQENLSYLRTGREAHLAY
NFPLPPLLLEAAVSGSADLLNRWLSRWPSLPESTALLNFTACHDGVGLRPLEGLMPPSRL
RELLIACEQRGGLVSHRRLADGSEVPYEINISWWSAMADGGLDPSYRQRERFLLTQLMVL
ALPGVPAIYLPALLATANDLGRFRRTGHRRDLNRPQFTRRSVERRLQDPDSDAAAVVTVL
KQALAVRARQPALHPDGQLEVLSPDREDRVVLHRSHAGHHLLAVHNVTSTRLSLDPSGLL
DQEEASPWVDCLSGRTLEPRKRHLLNPYEVLWLVRS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtttcagagcgagcgaacgctggggaatctgctgagatgcctttacgagtgccat
ccttccggggatctcgagagcttgtcgtcgcaattgctgcagattctcggctctgcatcg
gcgaatggcgaaatccgcacccaaggcaatccctggtgtgtcgacgatgtggtgctgatt
acctacgccgacacagtcgttgaggacgatcagccggccttggtgagtcttcgcaccttt
ttgaattgccatctctcagagttcgccgccgttctccacgtgttgccgttcctggaggcc
tcaagcgatggcggattcgcggtggccagtcacgaacgtctggaggaacgccatggtgat
tggagcgacctggcggagcttgcgcaggggcgcaggttgatggctgatctggtcttgaac
catgtgtcggcctcccatccctgggtgcgccagttcttgcgcgatcaggagccgggtcgg
ttctgcgtgttggaagcgggtcctgatccctgttgggacaacgtggtgcgtccccgcagt
tccgccctgttcaccaagctccagggtccgatcagcatgcgtgaggtttggaccacattt
gggcccgatcaggtggatgtggactggcgccatcccgaggtgctgcttggattcacccgt
ctgctcgctcgcatggtgacccatggggtgggctggatccgtctggatgcggtgggcttc
gtctggaaagagcccaacaccacctgcatccacctgccgcaagcccaccagctggtggaa
ctcctgcgtcagttgctcacgatcgcttgcgcaaacggggtggtggtcacggaaacgaat
gttccagagcaggagaatctctcgtatctgcgcacggggcgagaggcccatctggcctat
aactttcccctgccaccgttgctgcttgaggcggctgtcagtggctccgctgatttgctc
aatcgttggctgtcgcgctggccgtcgctgccggagtcgacggcgttgctcaatttcacc
gcctgtcatgacggcgtggggctgagaccgctggagggattgatgccgccgtcacggctc
agggagctgctgatcgcctgcgagcagcgcgggggtctggtgagccatcgccgcttggcc
gatggttctgaggtgccttacgagatcaacatcagttggtggagcgccatggccgatggc
ggcctcgaccccagctaccggcagagggaacgctttctgctcacccagttgatggtgctt
gctctgcctggggtgccggccatctacctgccggctctgctcgccaccgccaatgacctc
ggtcgcttcaggcgcacggggcaccggcgcgatctcaaccgaccccagttcacacgccgg
tccgtggagcgtcgtctgcaggatccagacagcgacgccgcagccgttgtcacggtgctg
aagcaggcactcgcggtgcgggcaaggcagccggcgctgcatccggatggtcagctggag
gtgctgagcccagaccgggaggatcgtgttgtgctgcatcgatcccatgcaggccatcac
ctcttggcggtgcataacgtcacatcgacccgtctcagcctggatccctccggactgctc
gaccaggaggaggcctccccgtgggtcgattgcctcagtggccgcaccctggagccccgc
aaacgccatctgttgaacccttatgaagtgctctggctggtgaggtcatga

DBGET integrated database retrieval system