KEGG   Synechococcus sp. WH7803: SynWH7803_2533Help
Entry
SynWH7803_2533    CDS       T00524                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syx  Synechococcus sp. WH7803
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SynWH7803_2533 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SynWH7803_2533 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SynWH7803_2533 (thrC)
Enzymes [BR:syx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SynWH7803_2533 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2365569..2366675
Genome map
AA seq 368 aa AA seqDB search
MSVINAFRRRFSPAPVLQDWPGLIEAYRPWLPVTTSTPVVTLREGATPLIPVPSVAERIG
RDVKVFVKYDGLNPTGSFKDRGMTMAISKAKEAHCEAVICASTGNTSAAAAAYARRAGMR
AFVLIPDGYVAQGKLAQALVYGAEVLAIRGNFDRALDIVREVSDQFPVTLVNSVNPFRLQ
GQKTAAFEVIDALGDAPDWLCIPMGNAGNITAYWMGFQEYNQAGRSRKLPRMMGFQASGS
APLVNNTTVTDPDTIATAIRIGNPVNREKAIAARKASQGDFLDVTDAEIIEAYKLLGGQE
GIFCEPASAASVAGLLKRKDEVPTGATVVCVLTGNGLKDPDCAINNNDAAFHTDLDPDLG
TVARVMGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagtgatcaacgccttccgccgccgtttttccccggcaccagtccttcaagactgg
ccagggctgatcgaggcctatcggccttggctacccgtcacgacgtcaacccccgtggtc
acccttcgcgaaggcgccactcccctcattcctgtgccctcagtggccgaacgcatcggc
cgcgatgtgaaggtgttcgtcaaatatgacggcctgaaccccacggggtccttcaaggac
cggggcatgaccatggcgatcagcaaagcgaaagaagcccattgcgaggctgtgatctgc
gccagcactggaaacacatccgccgctgcggctgcgtacgcacgccgcgctggcatgcgc
gcttttgtgctgatccccgacggatacgtggcccaaggaaaactggctcaagccctggtg
tacggcgccgaggtgctggccatccgtggcaatttcgaccgggctctggacatcgtccgc
gaagtgtctgatcagttcccagtcaccctggtgaactccgtgaaccctttccgtctgcag
ggacagaaaacagcggccttcgaagtgatcgatgccctgggcgatgcgcctgattggctg
tgcattcccatgggcaacgcgggcaatatcactgcttattggatgggcttccaggagtac
aaccaggcagggcgcagccgcaaactgcccagaatgatgggcttccaggccagtggctcc
gcccctctggtgaacaacaccacggtgacggatccggacacgatcgccacagccatccgc
atcggtaatcctgtgaaccgcgagaaagcgattgccgcccgcaaagccagccagggtgac
ttcctcgacgtcaccgatgcagagatcattgaggcctacaagctgctcggcgggcaggaa
gggattttctgtgagccggcaagcgctgcttcggtggccggcctgctcaaaagaaaagac
gaggtgccaaccggagccacggtggtgtgcgtgctcaccggaaacggactgaaagacccg
gattgcgccatcaacaacaacgacgcggccttccacaccgaccttgatcccgatctcgga
accgtggcccgtgtgatgggcttctga

DBGET integrated database retrieval system