KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0087Help
Entry
SYNGTS_0087       CDS       T02098                                 

Gene name
ipk
Definition
isopentenyl monophosphate kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:syy00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(101884..102831)
Genome map
AA seq 315 aa AA seqDB search
MHSYTLHAPAKINLFLEILGDRPDGFHELVMVLQSIALGDKITVRANGTDDIRLSCGDSP
LANDATNLAYRAAQLMINNFPQAHDNYGGVDITLTKHIPMAAGLAGGSADAAAVLVGLDL
LWNLGLTRPELEQLAAQLGSDIPFCIGGGTAIATGRGEILDPLPDGNCFWVVLAKHRSIE
VSTPWAYQTYRQKFGKNYLNDDQSQRARRKTIHAGPLLQGIQHRNPGQIASHIHNDLEKV
VLPAHQPVAQLRQVLQSAGGLGTMMSGSGPSVFTLCREQAEAEQVLAIAKEKLNDPDVDF
WLTHTIGHGIQIMNN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcattcctacaccctccatgccccggccaaaattaatcttttcctcgaaattcttggc
gatcgccccgacggtttccacgaattggtaatggtgttgcagagcattgccctgggggat
aaaattaccgtgcgggccaacggcaccgatgacatccggctcagttgtggggatagtccc
ttggccaacgatgccaccaatttggcctaccgagcggcccagttgatgattaacaatttt
ccccaagcccatgataattacggcggcgtagatatcaccttgaccaagcatattcccatg
gcggcgggcttagcggggggctcggccgatgcagcggcggtgttagtcggtttagacctg
ctctggaatttaggcttaaccaggccggaattagaacagttagcggcccaactgggttcc
gacattcccttttgcattggcggtggcacggcgatcgccacgggacggggggaaatcctc
gaccccttaccggacggcaattgcttctgggtggtattggccaaacatcgttccatagaa
gtttctaccccctgggcttaccaaacctatcgtcaaaagtttggcaagaattacctaaac
gatgaccagtcccagcgagcccggcggaaaaccatccatgcagggcccctactccagggc
attcagcaccgcaacccagggcaaatcgccagccatatccacaacgatttagaaaaagtt
gtgctcccggctcatcagcctgtagcccagttacgtcaggtcctacagtcagcgggggga
ttgggcaccatgatgtccggctccggccccagcgtgtttaccctttgccgggagcaagca
gaagcggaacaggtcctggcgatcgccaaagaaaaattaaacgaccccgacgtggatttt
tggctaacccacaccatcggccacggcatccaaattatgaataattga

DBGET integrated database retrieval system