KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0087Help
Entry
SYNGTS_0087       CDS       T02098                                 

Gene name
ipk
Definition
(GenBank) isopentenyl monophosphate kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00900  Terpenoid backbone biosynthesis
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01130  Biosynthesis of antibiotics
Module
syy_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYNGTS_0087 (ipk)
Enzymes [BR:syy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SYNGTS_0087 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAK48835
Position
complement(101884..102831)
Genome map
AA seq 315 aa AA seqDB search
MHSYTLHAPAKINLFLEILGDRPDGFHELVMVLQSIALGDKITVRANGTDDIRLSCGDSP
LANDATNLAYRAAQLMINNFPQAHDNYGGVDITLTKHIPMAAGLAGGSADAAAVLVGLDL
LWNLGLTRPELEQLAAQLGSDIPFCIGGGTAIATGRGEILDPLPDGNCFWVVLAKHRSIE
VSTPWAYQTYRQKFGKNYLNDDQSQRARRKTIHAGPLLQGIQHRNPGQIASHIHNDLEKV
VLPAHQPVAQLRQVLQSAGGLGTMMSGSGPSVFTLCREQAEAEQVLAIAKEKLNDPDVDF
WLTHTIGHGIQIMNN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcattcctacaccctccatgccccggccaaaattaatcttttcctcgaaattcttggc
gatcgccccgacggtttccacgaattggtaatggtgttgcagagcattgccctgggggat
aaaattaccgtgcgggccaacggcaccgatgacatccggctcagttgtggggatagtccc
ttggccaacgatgccaccaatttggcctaccgagcggcccagttgatgattaacaatttt
ccccaagcccatgataattacggcggcgtagatatcaccttgaccaagcatattcccatg
gcggcgggcttagcggggggctcggccgatgcagcggcggtgttagtcggtttagacctg
ctctggaatttaggcttaaccaggccggaattagaacagttagcggcccaactgggttcc
gacattcccttttgcattggcggtggcacggcgatcgccacgggacggggggaaatcctc
gaccccttaccggacggcaattgcttctgggtggtattggccaaacatcgttccatagaa
gtttctaccccctgggcttaccaaacctatcgtcaaaagtttggcaagaattacctaaac
gatgaccagtcccagcgagcccggcggaaaaccatccatgcagggcccctactccagggc
attcagcaccgcaacccagggcaaatcgccagccatatccacaacgatttagaaaaagtt
gtgctcccggctcatcagcctgtagcccagttacgtcaggtcctacagtcagcgggggga
ttgggcaccatgatgtccggctccggccccagcgtgtttaccctttgccgggagcaagca
gaagcggaacaggtcctggcgatcgccaaagaaaaattaaacgaccccgacgtggatttt
tggctaacccacaccatcggccacggcatccaaattatgaataattga

DBGET integrated database retrieval system