KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0134Help
Entry
SYNGTS_0134       CDS       T02098                                 

Gene name
sll0228
Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYNGTS_0134 (sll0228)
Enzymes [BR:syy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SYNGTS_0134 (sll0228)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148022..148942)
Genome map
AA seq 306 aa AA seqDB search
MHSPNKFTSGPKQFLESEAITSYADAAVVVVPIPYEATTSYRKGCEHGPEAVLEASDQLE
AYDEELGTSPCHDLGIYTCAPLADSNKHPALAGDAMVTEVCDGIAPFVEDGKFVVAIGGE
HAITTGVVRAMQRGTSEPFTVVQIDAHGDMRDKFEGSCHNHACVMRRVLELGLPTLPIAI
RAICQEEADLIREKNIPVFWAREMADNPNWINEAIASITTQKVFLTIDMDGFDPGFMPGV
GTPEPGGLGWYEGLNFFRRLFQTKQVIGCDLMELAPVRGSVVSEFSTAKLAYKLMGYWGE
SQRKKL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtcctaataaatttacctctgggcccaaacagtttctggagtcggaagccatt
acctcctatgctgatgccgctgtggtggtggtgcccattccctatgaggcaactacttcc
taccgtaagggttgtgagcatggccctgaggcggtgctagaagcttcggaccagttggaa
gcctatgacgaagagttgggcacttccccctgccatgatttgggtatttacacctgcgct
cccctggcggacagcaataagcatcccgctttggctggagacgccatggtaacggaggtt
tgtgacggcattgccccttttgtggaagacggtaaatttgtagtggcgatcggtggggaa
catgccattaccactggggtagtgcgggctatgcaaagggggacatcggagccttttacg
gtggtgcaaattgatgcccatggggatatgcgggacaaatttgaaggttcctgccataac
catgcctgtgtaatgcgccgggtgttggaattgggcttacccactctgccgatcgccatt
cgggccatttgtcaggaagaggcagatttgattcgggaaaaaaatattcctgtgttttgg
gccagggaaatggccgataatcccaattggattaacgaggcgatcgccagcatcaccaca
caaaaagtctttctcaccattgatatggacggttttgatccggggtttatgccgggagtc
ggcacccctgaaccgggggggctaggttggtatgaagggttaaattttttccgccgtctt
tttcaaaccaagcaagtaattggttgcgacttgatggaactggccccagtgcgaggctcg
gtggtgtcggaattttctaccgctaaactagcctataagttgatgggttactggggagag
tcccaacggaaaaaactctag

DBGET integrated database retrieval system