KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0134Help
Entry
SYNGTS_0134       CDS       T02098                                 

Gene name
sll0228
Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:syy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148022..148942)
Genome map
AA seq 306 aa AA seqDB search
MHSPNKFTSGPKQFLESEAITSYADAAVVVVPIPYEATTSYRKGCEHGPEAVLEASDQLE
AYDEELGTSPCHDLGIYTCAPLADSNKHPALAGDAMVTEVCDGIAPFVEDGKFVVAIGGE
HAITTGVVRAMQRGTSEPFTVVQIDAHGDMRDKFEGSCHNHACVMRRVLELGLPTLPIAI
RAICQEEADLIREKNIPVFWAREMADNPNWINEAIASITTQKVFLTIDMDGFDPGFMPGV
GTPEPGGLGWYEGLNFFRRLFQTKQVIGCDLMELAPVRGSVVSEFSTAKLAYKLMGYWGE
SQRKKL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtcctaataaatttacctctgggcccaaacagtttctggagtcggaagccatt
acctcctatgctgatgccgctgtggtggtggtgcccattccctatgaggcaactacttcc
taccgtaagggttgtgagcatggccctgaggcggtgctagaagcttcggaccagttggaa
gcctatgacgaagagttgggcacttccccctgccatgatttgggtatttacacctgcgct
cccctggcggacagcaataagcatcccgctttggctggagacgccatggtaacggaggtt
tgtgacggcattgccccttttgtggaagacggtaaatttgtagtggcgatcggtggggaa
catgccattaccactggggtagtgcgggctatgcaaagggggacatcggagccttttacg
gtggtgcaaattgatgcccatggggatatgcgggacaaatttgaaggttcctgccataac
catgcctgtgtaatgcgccgggtgttggaattgggcttacccactctgccgatcgccatt
cgggccatttgtcaggaagaggcagatttgattcgggaaaaaaatattcctgtgttttgg
gccagggaaatggccgataatcccaattggattaacgaggcgatcgccagcatcaccaca
caaaaagtctttctcaccattgatatggacggttttgatccggggtttatgccgggagtc
ggcacccctgaaccgggggggctaggttggtatgaagggttaaattttttccgccgtctt
tttcaaaccaagcaagtaattggttgcgacttgatggaactggccccagtgcgaggctcg
gtggtgtcggaattttctaccgctaaactagcctataagttgatgggttactggggagag
tcccaacggaaaaaactctag

DBGET integrated database retrieval system