KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0387Help
Entry
SYNGTS_0387       CDS       T02098                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNGTS_0387 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    SYNGTS_0387 (hisD)
Enzymes [BR:syy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SYNGTS_0387 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
420502..421731
Genome map
AA seq 409 aa AA seqDB search
MLRLITQSGDIVQELRRLHHRPVPSPWPVMAQVVAAMEHWAAMDQDAPPRVSGAELDAAY
QRISQEKLSVIRQACAALEQVYRPQLPKTQVSFPEDGTVRGQRFYPVRRAGFYLEAKRGD
ALGNLLRQGMLAKTVGVAERVLVTETISSTILVAAQEMGIEEIYLAAGVPAIAMLTWGAK
NIAPVESITGAGCPRVMAAKQLVSGVVTIDQTLARTNLMVLADGEANGQWLALDLLAHAE
QYPNASAVLLTDRLELGEEVIQSVNRYCREQEHSVHTEKALAHYGLVAIVEDLEACGSWI
NEFCPHILLLAMEDPWTMVEKVQRAREIYIGHRSPSILGHYLSGANRLQTQDGAMATASE
LAFHCFLRSSQLLDYGNNPPPPWLKDLVNWQGLTAIEERLGQLGRLKES
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtctcatcacccagtccggtgacattgttcaggagttgcgacgtttacatcat
cgtcccgttccttccccctggccggtcatggcccaggtggtggcggcgatggagcattgg
gctgccatggaccaggatgctccccccagagttagtggagcggagttggatgcggcttat
caacgcattagccaggaaaaattgtcggtgattcgccaggcttgcgctgccctggagcag
gtttaccgcccgcaactgcccaagacccaagtaagctttccggaagatggcacagtgcgg
ggacaaaggttttatccggtcagaagagctggtttttatctagaagcaaaaaggggcgat
gccctgggcaatttactccgccaggggatgttggccaagactgtgggggtggcggaacgg
gttttggtgacggaaaccattagttcgactattttggtggcggcccaggaaatgggcatt
gaagaaatttatctggccgctggggtgccggcgatcgccatgctgacctggggagcaaaa
aatattgccccggtggagtccattacaggggcaggctgcccaagggtgatggcggctaaa
caattggtgagtggtgtggtaaccattgaccaaaccctggctaggacaaatttaatggtg
ctagcggacggtgaagctaacggacaatggctagccctggatttgttagcccatgccgaa
caatatcccaatgccagcgcagtgctactgaccgatcgcctggagttgggggaagaggtg
attcaatcagtcaatcgctattgtcgggagcaggaacattctgtacatacggaaaaggct
ttggcccattacggcctagtggcgatcgtcgaagacctagaggcctgtggaagttggatc
aatgagttttgcccccatattttactgttagccatggaagacccctggaccatggtggag
aaagttcagcgagccagggaaatttacatcggccaccgcagtccgagcattttgggtcat
tacctcagtggggccaaccgtctgcaaacccaggatggggccatggccaccgctagtgaa
ttggcattccattgttttctgcgctccagtcaattactcgactacggcaataatccaccg
cccccttggttaaaggatttggtcaattggcaaggcctgacggcgatcgaggaacgcttg
gggcaattgggtcgactcaaggaaagttag

DBGET integrated database retrieval system