KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_0700Help
Entry
SYNGTS_0700       CDS       T02098                                 

Gene name
folP
Definition
dihydropteroate pyrophosphorylase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
771651..772520
Genome map
AA seq 289 aa AA seqDB search
MDQLDQLSDYFPPPLPVGQTLFDWGKRTYVMGILNTTPDSFSDGGEFNSLPTAIHQAKTM
VQGGAHIIDIGGQSTRPGAETVSLKEELERTIPIIQALRQELDIPISIDTTRAEVARQAL
QAGADMVNDISGATFEPEILAVAAQHKAPIILMHIRGNPQTMQNLTDYGDLIGEMRQFFS
AQVDLARHYGVLPEQIILDPGIGFAKTAEQNITLLRQLPELKRLGFPLLVGPSRKSFIGK
ILDQPDPKERVWGTGATCCRAIAGGADIVRVHDVEAMAQICKVADALWR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaccagttggatcaattgagtgattattttccccctcccctcccggtgggccaaacc
ctttttgattggggcaaacgcacctatgtgatgggaattttgaatactacgccggacagt
tttagtgatgggggcgaatttaactctctaccaacggccatccaccaggctaaaaccatg
gtgcaggggggagcacacattattgacattggcggccagtccacccgaccgggggcagaa
actgttagcttgaaggaagaattagagcgcactattccgattatccaagctctccggcaa
gaattagacattcccatttccatcgataccaccagggcggaagtggcacgacaagctctc
caagccggagcggatatggtcaacgatatttccggagctacctttgaaccagaaattttg
gcggtcgccgcccagcacaaggctccgattattttgatgcacatacggggtaacccccaa
actatgcaaaatttgacggattatggggatttaatcggggaaatgaggcagtttttcagc
gcccaagtagatctagcccgccattacggcgtattgcccgaacagattatccttgaccca
ggcattggctttgctaaaaccgctgagcaaaatattaccctactgcgccagttaccggag
ctaaaaagacttggttttcccctattggtggggccatcccggaaaagtttcattggcaaa
attcttgaccaacctgatccgaaggaaagagtttggggtactggggcgacctgctgtcgg
gcgatcgccgggggagcagatatagtcagagtccatgatgtggaagccatggcccagata
tgtaaggttgcagatgccctatggcgatga

DBGET integrated database retrieval system