KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_1088Help
Entry
SYNGTS_1088       CDS       T02098                                 

Gene name
sll1775
Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SYNGTS_1088 (sll1775)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SYNGTS_1088 (sll1775)
Enzymes [BR:syy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SYNGTS_1088 (sll1775)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1207566..1210019)
Genome map
AA seq 817 aa AA seqDB search
MSLLVQKPEIPACAWQRSIGKDWEKPYTVRYASNLDDGPDHGMPLGGFGAGCIGRSPTGK
FNLWHLDGGNHIFKNLPACQFSVYEQVAGEEAKAYAMATEAPEDGSLDRWQWYPKEKGEY
SALYPRSWYEYKDVFKSELICEQFSPVWGGNYQESSYPLAVFDWTVHNPTDKPITLSIML
TWQNSVGWFTNAIKSPTVKLRDDGSPEYEYQPRWGDSTGNFNQWIQDGFRVGCLFNRVQP
HEALREGEGQMCIASVSNPSVEVFYHNRWNPSGDGADVWDWFAGNGSLPDIQDETAAEPG
EQIAGAICLRFTVRPGKTKKIPFLLAWDLPITEFAQGVTYYRRYTDFYGRNGKNVWSMIR
TALKHSDTWRKKIEAWQAPILENPRLPDWLKMSLFNELYLLTQGGTLWTAATENDPVGQF
GVCECMDYRWYESLDVRLYGSFGLLMHWPKLEQAVMLAFARAIPTEDPKERVIGYNLSLA
PRKVKNATPHDLGAPNEHPWERSNYTAYQDCNLWKDLGSDFVLLVYRDFLLLPDADGEFL
GECWPSIVAALDYLKGFDLDNDGIPENSGAPDQTFDDWRLQGISAYCGGLWIAALEAALV
MGQYLLENPPQQTDLDAMEIQTAIARYETWLAQARSLYQDTLWNGEYYNLDSQSGSKVVM
ADQLCGQFYARLLNLPDVVEHHYAEKALAKVYDTCFLKFAHGELGAANGLLPDGSPQNPN
DTHPLEVWTGINFGLAAFLIQMGMKEEALKMTETVVNQVYNNGLQFRTPEAITAVGTFRA
SHYLRAMAIWAVYGLLEGFSNLPIAPADDEVPTSDFY
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgttagtccagaaacctgaaattcctgcctgcgcttggcaacgatccattggt
aaggattgggaaaagccctacactgtacgctacgccagtaaccttgacgatggcccggac
catggtatgcccctaggggggtttggagccggttgcattgggcgatcgccaacggggaaa
tttaacctgtggcatttggacgggggcaaccacatttttaaaaatttgcctgcttgtcaa
tttagtgtttacgaacaggtggcaggggaagaagccaaagcctatgccatggcaacggaa
gcccctgaagatggcagtttggaccgttggcaatggtaccccaaagaaaagggagaatac
agcgccctctatccccgcagttggtacgaatataaagacgtttttaaaagtgaattaatt
tgtgaacagttttccccagtgtggggcggcaactaccaggaaagtagctatcccctggcg
gtttttgattggactgtccataatcccaccgataaacccatcaccctgagcattatgctc
acctggcagaacagcgttggctggttcaccaatgccatcaaatcccccactgtcaaattg
cgggacgatggtagcccagagtatgaataccaaccccgctggggcgacagtacagggaat
tttaaccaatggatccaggatggtttccgggttggttgtttatttaatcgggtacaaccc
cacgaagccctccgggaaggggaagggcaaatgtgcatcgccagcgttagtaatcccagc
gtagaagtgttttaccataaccgttggaatcccagtggggatggggcagatgtgtgggat
tggtttgcgggcaatggctccctaccggatatccaggatgaaacggcggcggaaccgggg
gaacaaattgcgggagctatctgtttacgcttcactgtgcgaccaggaaaaacgaagaaa
attcccttcctactggcgtgggatttgcccattacggaatttgcccagggggtgacctat
taccgccgctatacggatttctacggccgcaatggcaaaaatgtttggtccatgatccgc
acggcgttgaaacatagcgatacctggcggaaaaaaattgaagcttggcaggctcccatt
ctggaaaatccccgtttaccggattggctcaaaatgtccctctttaatgagttatacctg
ttaacccaggggggaaccctgtggacagcggcgacggaaaacgacccagtcgggcagttt
ggggtctgtgaatgcatggactaccgctggtatgaaagcttagatgtgcggctttacggc
tcctttgggctattgatgcattggcctaagttggagcaggcggtgatgttggcgtttgcc
cgagccattcccacggaagatcccaaggaacgggtaattggctataacctttccctcgct
ccccgcaaagtgaaaaatgccactccccacgatctgggggctcccaacgagcatccttgg
gaaaggagtaattacactgcttaccaggactgtaacctctggaaggatttgggcagtgac
tttgttttattggtctatcgagactttttacttttacccgatgcggatggggaatttttg
ggggaatgttggcccagcattgtggcggcgttggattatctgaaaggatttgatcttgat
aacgatggtattcccgaaaattccggcgcaccggatcaaacctttgacgattggcgcttg
cagggtattagtgcctactgtggtgggctatggattgcggccctagaggcggctttggtg
atggggcaatatctgctggaaaaccccccccaacaaacggatctagatgctatggaaatc
caaacggcgatcgccaggtatgaaacttggttagcccaagcccgtagtttgtaccaagac
accctttggaatggggaatactacaacctagatagtcaaagcggttccaaggtggtgatg
gcggatcaactgtgtgggcaattttatgcccggttattgaatctgccggatgtggtggag
caccattacgctgaaaaggctttagccaaggtgtacgacacctgtttcctcaaatttgcc
catggtgaactgggagccgccaatggtcttttacccgacggttccccccaaaatcccaac
gatacccatcccttggaagtttggacggggattaacttcggtttagcggcctttttgatc
caaatgggcatgaaagaagaagctttaaaaatgacagagacggtggttaatcaggtgtat
aacaatggtttacagttccgcactccagaggcaatcactgcggtgggtactttccgggcg
agtcattatctgcgggccatggcaatctgggctgtgtacggcttgctagagggttttagc
aatttacccattgctcccgccgatgacgaggtacccactagcgatttttattga

DBGET integrated database retrieval system