KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_1305Help
Entry
SYNGTS_1305       CDS       T02098                                 

Gene name
slr1992
Definition
(GenBank) glutathione peroxidase
  KO
K20207  
hydroperoxy fatty acid reductase [EC:1.11.1.22]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Enzymes [BR:syy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.22  hydroperoxy fatty acid reductase
     SYNGTS_1305 (slr1992)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1435516..1435980
Genome map
AA seq 154 aa AA seqDB search
MPLPTSLTTLDGTPLAPEVIADKVVLFVNVASKCGLTPQYSGLVALDKAYGEKGLVIIGV
PCNQFGAQEPGSPEEIKDFTKTKYDVDFTLLEKQDVNGPNRSPLYQFLVGDGEDISWNFG
KFLIGRDGQVVARFDPQTKPDDTNLKAAIEKALG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgccattacccacttccctgaccaccctggatggaacgcccctggccccggaggtcatt
gccgataaagttgtcctttttgttaacgttgccagtaagtgcggcttaaccccccaatac
agcggcctagtggctttggacaaggcctatggagaaaagggcttagtaattatcggtgtg
ccctgcaaccaatttggggcccaggaaccaggctccccagaggaaatcaaagatttcacc
aaaaccaagtacgacgttgatttcaccttgttggaaaagcaggacgtcaatggtcccaac
cgcagtcccctctaccaattccttgtgggggatggggaagatattagctggaactttggc
aaatttttaattggtcgggatggacaggtggtggctcgctttgacccccaaactaaaccc
gatgacactaatctcaaggcggcgatcgaaaaagccttgggctaa

DBGET integrated database retrieval system