KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_1305Help
Entry
SYNGTS_1305       CDS       T02098                                 

Gene name
slr1992
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:syy00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:syy00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1435516..1435980
Genome map
AA seq 154 aa AA seqDB search
MPLPTSLTTLDGTPLAPEVIADKVVLFVNVASKCGLTPQYSGLVALDKAYGEKGLVIIGV
PCNQFGAQEPGSPEEIKDFTKTKYDVDFTLLEKQDVNGPNRSPLYQFLVGDGEDISWNFG
KFLIGRDGQVVARFDPQTKPDDTNLKAAIEKALG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgccattacccacttccctgaccaccctggatggaacgcccctggccccggaggtcatt
gccgataaagttgtcctttttgttaacgttgccagtaagtgcggcttaaccccccaatac
agcggcctagtggctttggacaaggcctatggagaaaagggcttagtaattatcggtgtg
ccctgcaaccaatttggggcccaggaaccaggctccccagaggaaatcaaagatttcacc
aaaaccaagtacgacgttgatttcaccttgttggaaaagcaggacgtcaatggtcccaac
cgcagtcccctctaccaattccttgtgggggatggggaagatattagctggaactttggc
aaatttttaattggtcgggatggacaggtggtggctcgctttgacccccaaactaaaccc
gatgacactaatctcaaggcggcgatcgaaaaagccttgggctaa

DBGET integrated database retrieval system