KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_1491Help
Entry
SYNGTS_1491       CDS       T02098                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641105..1642088)
Genome map
AA seq 327 aa AA seqDB search
MFPTIRPRRLRQTDVLRRMVRENTLTVNDLIYPLFAVPGNAIAKEVVSMPGVYQLSVDKI
VDEAKEVRDLGIPAIILFGIPEDKDTDATGAWHDCGIVQKATEAVKKAVPDLVVIVDTCL
CEYTNHGHCGYLETGDLTGRVLNDPTLELLKKTAVSQANAGADVIAPSGMMDGFVQAIRE
ALDDHDFQNIPILSYAAKYASAYYGPFRDAADSSPQFGDRRTYQMDPGNSREALKEVELD
LLEGADMVMVKPALSYMDIIWRIKEMTNLPVAAYNVSGEYSMVKAAALNGWIDEQKVTLE
TLTSFKRAGADLILTYHAKDAARWLQD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaccatccgtccccgtcgcctgcgccaaactgatgttcttcgccgcatggtc
agggaaaataccctcaccgtcaatgatttgatctatcccttgtttgccgttcctggtaat
gccattgccaaggaagtagtttccatgcctggagtgtaccaactgtcggtggataaaatt
gttgacgaagctaaagaagtacgggatttaggcattccggccattattctgtttggtatt
cccgaagataaggataccgatgccacgggagcttggcatgattgcggcattgtccaaaag
gcgacggaagcggtgaaaaaagcggtgccagatttggtggtaattgtcgatacctgtttg
tgtgaatataccaaccatggccactgtggctatctggaaacgggggatttgaccggccgg
gtattgaacgaccccaccttggaattgttgaaaaaaaccgctgtttcccaagctaatgct
ggggcagatgtcattgctccctcggggatgatggatggttttgtccaggcgattcgggaa
gccttggatgaccatgatttccaaaatattcccattctgtcctacgcggctaagtatgct
tcggcctattacggccccttccgggatgcggcggattcctctccccaattcggcgatcgc
cggacctaccaaatggatccaggcaatagtcgggaagcgttgaaagaagtggagttggat
ttgctagagggggcggatatggtgatggtcaaaccggctttgtcctatatggatattatt
tggcgcattaaggaaatgaccaatttaccagtggcggcctataacgtgtctggggagtat
tccatggtgaaggcggccgccctaaacggttggattgacgaacaaaaagttaccctggaa
accctcaccagctttaaacgggccggggcagatttgattttgacctaccatgctaaggat
gcggcccgctggctacaggactag

DBGET integrated database retrieval system