KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_1677Help
Entry
SYNGTS_1677       CDS       T02098                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:syy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:syy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1833325..1834320
Genome map
AA seq 331 aa AA seqDB search
MTMVASWTRNHILDLTDWRGEELDIVLQTATTFQQVLSGQTKKVPALQGQVVTNLFFEPS
TRTRSSFELAAKRLSADVMNFSPGTSSLTKGETILDTAKTYLAMGSDIFVIRHQQAGVPH
FIASQMDRLQTGVKVLNAGDGQHEHPSQGLLDLFTICSQFAPDNPAIQCLQGKKIAVVGD
ILHSRVARSNLWSLTTAGADVHLAGPPTLLPKEFQQLTLAPGSGKLHCHWQLQPALEGAD
IVMTLRLQKERMTAHLLPSLREYHHYFGITHDRLKVCQPGVKVLHPGPVNRGVEISSELM
DDPDISLIQDQVTSGVAIRMALLYLLGTVQE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggtggccagttggactcgaaaccacattttagacctaaccgattggcggggc
gaagaattagacattgtgctacagaccgccaccacattccagcaagtactgagtggacaa
acaaaaaaagtacctgccctccagggacaagtagtcaccaatcttttttttgagccatct
acccgcacccgcagcagctttgagttagcggccaagcgcctttccgctgatgtgatgaat
ttttcccctggtacttcttcccttaccaagggagagactattttggacaccgccaaaact
taccttgccatggggtctgacatttttgttatccgccaccaacaggccggggtgccccat
ttcattgcttcccaaatggaccggctccaaaccggagtcaaggtactcaatgcgggggat
gggcaacatgagcatccttcccaaggattactggatttatttactatctgctcccaattt
gcgccggacaatcctgccattcaatgcctccagggaaagaagatcgcggtggtaggagac
attttacattcccgggtggcgcgttctaatctgtggagtctaactaccgccggggctgac
gtgcatttagcggggcctcccaccctgttaccaaaggaatttcaacaattaaccctagcg
ccgggatcgggtaaactccattgtcattggcagttgcagccagccttggaaggggcggat
atagttatgactttgcggttgcaaaaagaacggatgacagcccatcttttacccagtttg
cgggaataccaccattatttcggcattacccacgatcgcctaaaggtgtgtcaaccaggg
gtaaaagtgctgcatccggggccggtgaatcggggggtagaaattagctccgaactgatg
gatgacccggacattagcttgatccaagaccaagtaaccagtggagtagccatccgcatg
gctctactttatttgctaggcactgttcaggaatag

DBGET integrated database retrieval system