KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2019Help
Entry
SYNGTS_2019       CDS       T02098                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SYNGTS_2019 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNGTS_2019 (rfbC)
Enzymes [BR:syy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SYNGTS_2019 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2226645..2227193
Genome map
AA seq 182 aa AA seqDB search
MNVIPTTIADVLILEPKVFGDERGFFFESYNDKVFQQAVGIEPHFVQDNHSFSRQGVVRG
LHYQIQHPQGKLVRVARGEIFDVAVDLRRNSPSFGQWVGCVLNDHNKRQLWIPAGFAHGF
AVLSPEAEVLYKATDYYAPSYERTLLWNDPAIGIDWSLTTTPLLSLKDQRGLPLAEAEVF
DF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtgattcccacaactatcgccgatgtgttgattttggagcccaaagtctttggc
gatgaacggggttttttctttgagagctacaacgacaaggttttccagcaggcagtgggc
atagaaccccattttgtgcaggacaatcattccttttctcgtcagggggtagtgcggggg
ttacattatcaaatccagcatccccagggaaaattagttcgggtggcccggggagaaatt
tttgatgtggcagtggatctgcgccgtaattcccctagttttggccagtgggtgggttgt
gtgctcaatgaccacaataaaagacagctatggattcccgccggttttgcccacggtttc
gccgttctttccccggaggcagaggtgctgtataaagcaacggattactatgcaccgtcc
tatgagcgcaccctattgtggaatgacccggccattggcattgattggtcgttaaccacc
actcccctattatctctcaaggatcaacggggtcttcccctagccgaagcggaggtgttt
gatttttaa

DBGET integrated database retrieval system