KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2180Help
Entry
SYNGTS_2180       CDS       T02098                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Pathway
syy00010  Glycolysis / Gluconeogenesis
syy00051  Fructose and mannose metabolism
syy00562  Inositol phosphate metabolism
syy00710  Carbon fixation in photosynthetic organisms
syy01100  Metabolic pathways
syy01110  Biosynthesis of secondary metabolites
syy01120  Microbial metabolism in diverse environments
syy01130  Biosynthesis of antibiotics
syy01200  Carbon metabolism
syy01230  Biosynthesis of amino acids
Module
syy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNGTS_2180 (tpi)
   00051 Fructose and mannose metabolism
    SYNGTS_2180 (tpi)
   00562 Inositol phosphate metabolism
    SYNGTS_2180 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNGTS_2180 (tpi)
Enzymes [BR:syy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SYNGTS_2180 (tpi)
Exosome [BR:syy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SYNGTS_2180 (tpi)
  Exosomal proteins of bladder cancer cells
   SYNGTS_2180 (tpi)
  Exosomal proteins of melanoma cells
   SYNGTS_2180 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Hs1pro-1_N
Motif
Other DBs
NCBI-ProteinID: BAK50928
Position
2422437..2423165
Genome map
AA seq 242 aa AA seqDB search
MRKIIIAGNWKMHKTQAEAQAFLQGFKPLIEDAAESREVVLCVPFTDLSGMSQQLHGGRV
RLGAQNVHWEASGAYTGEISAAMLTEIGIHYVVIGHSERRQYFGETDETANLRVLAAQKA
GLIPILCVGESKAQRDAGETEQVIVDQVKKGLVNVDQSNLVIAYEPIWAIGTGDTCAATE
ANRVIGLIREQLTNSQVTIQYGGSVNANNVDEIMAQPEIDGALVGGASLEPQSFARIVNF
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaatcattattgcgggcaattggaaaatgcataagacgcaggcggaggcccaa
gcgtttttgcaggggtttaaacctttaatcgaagatgcggcggaaagtcgtgaggtggtg
ttgtgtgttcctttcaccgatttgagcggcatgtcccaacaactccatggcggtagggtc
cgcctaggggcacaaaatgtccattgggaagcgagtggggcctacacaggggaaatttca
gcggctatgttgacggaaatcggtattcattatgtggttatcggccacagtgaacgacgg
caatattttggggaaacggacgaaactgccaatttgagagtattggcggcccaaaaggcg
ggcttaattcccattctgtgtgtgggggaaagtaaggcgcaacgggatgccggagaaacg
gaacaggttatcgttgaccaagtgaaaaaaggcttggtgaatgtggatcaatctaaccta
gtcatcgcctacgagccgatttgggccattggtacaggggacacctgtgcggcaacggaa
gccaatcgggttattgggctgattcgggaacagttaactaattcccaggtcaccatccag
tatggcggttcggtcaatgccaacaatgtggatgaaattatggcccaaccggaaattgat
ggagccttggtgggaggagctagtctggaaccccagagctttgcccgcattgttaatttt
cagccctga

DBGET integrated database retrieval system