KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2212Help
Entry
SYNGTS_2212       CDS       T02098                                 

Gene name
sll0024
Definition
(GenBank) hypothetical protein
Organism
syy  Synechocystis sp. PCC 6803 GT-S
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
complement(2460174..2460995)
Genome map
AA seq 273 aa AA seqDB search
MKITCLKHSQIRGNQRNCLNNWDVDRLIPIDYQIPTKILDNVENNLKNDFCLLLSRDVYS
EGDAKFLYNYLLSRQQDLSDDFLALLPRWLGDEQKHYQALRRVYRFLSELNFAAMDDNFQ
RRSPSLEQIDWVLQDEFTIVSTLVFDELGSMFSYRRDLREYYQPFGKVLSRVGQHLVQDE
GSHFRHFLNILQQNHSHRLKELPDFFHSLIKLEKSLGCYYHTFLLDHAQEMHRFPSYFSE
VIAQLILAELNLGDRPSNTIIKSLTQSSFSSNP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattacttgtttaaaacatagtcaaataaggggaaatcaaaggaattgtttaaac
aattgggatgtggacagactaatccccatcgactatcaaatccctactaagattttggat
aatgtagaaaacaatctaaagaatgatttttgccttttactaagtcgagatgtttattcc
gaaggtgatgctaagtttttatacaactatttactctcccgtcaacaggatttatccgac
gattttttagctttattaccccgatggctgggagatgaacaaaaacattatcaagctctg
cggcgagtttatcgctttttatctgagctaaattttgccgctatggatgacaattttcag
cggcgatcgcctagtctggaacaaattgattgggttttacaagatgaattcaccattgtt
agcaccctagtctttgacgaattggggtctatgttttcttaccgtcgggatttacgggaa
tattatcaaccttttggcaaagtattgagtcgtgtgggacaacatttagtccaggatgaa
ggtagccattttcgccactttttaaatattctccaacagaatcattctcaccgtttaaag
gaattaccggatttttttcatagtttaatcaaattggaaaaatccctggggtgttattac
cacacttttttgttagaccatgcccaagaaatgcaccgttttcccagctattttagcgag
gtcattgcccaattaattttggctgaattaaaccttggcgatcgccctagtaacaccatt
attaaatccttaacccaatcttctttttcttctaatccatga

DBGET integrated database retrieval system