KEGG   Synechocystis sp. PCC 6803 GT-S: SYNGTS_2221Help
Entry
SYNGTS_2221       CDS       T02098                                 

Gene name
mltA
Definition
(GenBank) membrane-bound lytic transglycosylase A
  KO
K08304  
membrane-bound lytic murein transglycosylase A [EC:4.2.2.-]
Organism
syy  Synechocystis sp. PCC 6803 GT-S
Brite
Enzymes [BR:syy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     SYNGTS_2221 (mltA)
Peptidoglycan biosynthesis and degradation proteins [BR:syy01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   SYNGTS_2221 (mltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2472461..2473612)
Genome map
AA seq 383 aa AA seqDB search
MIKQFFPLLALLLVFGFHGSGLRAQSRPLMPVTGANLTPTVGFDEQLWGNHCSAGDKQSL
LRAIDHSLSYLKTASAARAYQNYSVPGVTRERVTRSLQRFKTLLQQSPSPEALQTAVARE
FQFYQAIGNDGKGTVHFTGYFEPVYTASRQRTAEYRYPIYGLPNNFSRWSKPHPTRADLE
GMDGLGKSSQLQGREIAWFRNRLDAYLIQVQGSAKINWVGGGQSSVAFAGATDYPYVSLG
KETIQEGIFQPGEVTLPKLIDYFEQNPSELSRFIPRNNRLIFFKETSASTPAKGSIGVPV
TAERSIATDKFLMPPGAIAVLAAPIPDCQGQKVNVSRFVVDQDTGSAIKGPGRVDIFMGT
GQTPGDRAGLMSDDGQIYYLLLR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcaatttttcccgttattggctttactgttggtttttggcttccatggcagt
ggtcttagggcccagtcgcgaccattaatgccagtaacgggggcaaatctaacgccaacg
gtgggttttgatgaacagttgtgggggaaccattgctcagcgggagataaacaatctttg
ctccgggcgatcgaccatagcttgagctatttaaaaactgctagcgccgcccgagcttat
caaaattactctgtaccgggggtgaccagagagcgggtaacccgttccctccagcgattt
aaaactttgttgcaacagtctcccagtcccgaagctctccagaccgctgttgccagggaa
tttcagttttatcaggcgatcggtaacgatggcaagggcacagtccatttcactggttat
tttgaaccagtttataccgccagtcgtcaacgcactgccgaatatcgttatcccatttat
ggtttgcccaataatttttctcgttggtctaagccccaccccactagggctgacttggaa
ggtatggatggtttaggcaaatcaagtcagttacagggacgggaaattgcttggttccgt
aatcgtctagatgcctatctaatccaggtacagggttctgccaaaatcaactgggtgggg
ggaggccaaagttccgtggcctttgctggagcgacggattatccctacgtaagtttaggg
aaggaaaccatccaagagggaattttccagcctggggaggttactttgcctaagttaatc
gactattttgagcaaaatcccagcgaactaagtcgttttatcccccgcaataatcgtcta
attttctttaaggaaacctccgccagcacccccgccaagggcagtattggggtgccagtt
actgccgagcgttccattgccaccgataaattccttatgcctccaggggcgatcgccgtt
ttagcggctcccattcccgattgtcagggtcaaaaagtcaacgttagtcgttttgtggtg
gatcaggataccggcagtgccatcaaaggccccggtcgggtggatattttcatgggcact
ggccaaactcctggcgatcgagccggtttgatgagtgacgacggccaaatttattacctg
cttctacgctag

DBGET integrated database retrieval system